hmrM

Accession ARO:3003953
DefinitionhmrM is a multidrug efflux pump belonging to the MATE family and functions as a Na+/drug antiporter.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter
Drug Classfluoroquinolone antibiotic, acridine dye
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesHaemophilus influenzaeg
Resistomes with Sequence VariantsHaemophilus influenzaeg+wgs, Streptococcus pneumoniaewgs
Classification8 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ multidrug and toxic compound extrusion (MATE) transporter [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Publications

Piddock LJ. 2006. Clin Microbiol Rev 19(2): 382-402. Clinically relevant chromosomally encoded multidrug resistance efflux pumps in bacteria. (PMID 16614254)

Xu XJ, et al. 2003. Microbiol. Immunol. 47(12):937-43 Molecular cloning and characterization of the HmrM multidrug efflux pump from Haemophilus influenzae Rd. (PMID 14695443)

Resistomes

Prevalence of hmrM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Haemophilus influenzae95.71%0%99.41%
Streptococcus pneumoniae0%0%0.01%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 900


>gb|ADO96486.1|-|hmrM [Haemophilus influenzae R2846]
MNFRLLSQYHTDIKKLIKISLPILLAQIAQNSMGLADTIMAGRVSSTDMAAISIGASIWMPLMFFGQGLLLALPPTISYLNGSGQHHRIA
HQVRQGIWLVLGVSIPLGLLIYFCEIPLQYMQMESKMSDLARNYLHAMLWGLPAYLMLINFRCLNDGIEKTKPAMVITFLGLLINIPLNY
IFIYGKFGMPAFGAVGCGIATAIVNWAMCLMMIFYSYTNTQERSLKVFSQLIEMPNPKTLKKLLRLGLPIAIAICCEVALYALTSLMLSP
LGATIVASHQITLNTSSFIFMFPMSIGMATTILVGQALGAGSPQNAKKIGYAALLLGLTVTIVTALITIFFRYEIASIFVTDEIVIAMAA
NLLLFAALYQFSDTIQMVVGGILRGYKDTKVILYITLFSYWVIGVPLGYTLGRTDWLVPHIDAKGFWIAFVVSLTFAAFLLSLRMKKMQA
MNDNAILQRLEKLK


>gb|CP002276.1|-|1144674-1146068|hmrM [Haemophilus influenzae R2846]
ATGAATTTTCGTCTTTTATCTCAATACCACACTGATATTAAAAAGTTGATTAAAATTTCCTTGCCTATTTTATTAGCGCAAATTGCACAA
AACTCAATGGGATTAGCGGATACCATTATGGCGGGGCGAGTGAGTTCCACTGATATGGCAGCCATTTCTATTGGTGCTTCAATTTGGATG
CCATTGATGTTTTTTGGGCAAGGTTTATTGTTGGCATTGCCGCCTACAATTTCTTATTTGAATGGTTCAGGCCAACACCATCGCATTGCA
CATCAAGTTCGCCAAGGCATTTGGCTTGTGTTAGGCGTGAGTATTCCTTTAGGTTTACTGATTTATTTCTGTGAAATTCCGCTGCAATAT
ATGCAAATGGAAAGCAAAATGTCAGATTTAGCACGCAATTATTTACACGCGATGTTGTGGGGATTGCCAGCTTATTTGATGCTGATTAAT
TTTCGTTGTTTAAATGATGGGATTGAGAAAACCAAGCCTGCGATGGTCATTACCTTTTTAGGTTTATTGATTAATATTCCGCTTAATTAC
ATTTTTATTTATGGAAAATTTGGTATGCCTGCTTTTGGTGCGGTGGGCTGTGGTATTGCGACAGCTATTGTGAACTGGGCAATGTGCTTA
ATGATGATTTTCTATTCCTACACGAATACTCAAGAACGTTCACTAAAAGTATTTAGTCAATTAATTGAAATGCCAAATCCGAAAACACTT
AAAAAATTACTGCGTTTAGGATTACCCATTGCCATTGCAATTTGTTGCGAAGTGGCGTTATATGCACTTACGTCCTTAATGCTTTCTCCG
CTGGGTGCAACTATTGTGGCAAGCCATCAAATTACGCTGAATACTAGTTCTTTTATTTTTATGTTCCCTATGTCGATTGGTATGGCAACG
ACGATTTTAGTTGGACAAGCATTGGGTGCAGGTTCTCCACAAAATGCGAAGAAAATTGGCTATGCCGCATTATTATTAGGGCTAACTGTG
ACAATTGTTACTGCATTAATTACGATTTTTTTCCGTTATGAAATTGCATCGATCTTCGTGACAGATGAAATTGTCATCGCCATGGCAGCA
AATCTATTATTATTTGCCGCACTTTATCAATTTTCAGATACCATTCAAATGGTGGTTGGTGGTATTTTACGTGGTTATAAAGATACTAAA
GTCATTTTATACATTACCCTTTTCTCTTATTGGGTAATTGGTGTGCCACTTGGTTATACGCTAGGTCGTACAGATTGGCTTGTGCCACAC
ATTGATGCGAAAGGTTTCTGGATTGCCTTTGTGGTCTCGCTCACTTTTGCGGCATTCTTACTTTCTTTGAGAATGAAAAAAATGCAAGCT
ATGAACGACAACGCTATTTTACAACGTTTAGAAAAACTTAAATAA