hmrM

Accession ARO:3003953
CARD Short NamehmrM
DefinitionhmrM is a multidrug efflux pump belonging to the MATE family and functions as a Na+/drug antiporter.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter
Drug Classfluoroquinolone antibiotic, disinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesHaemophilus influenzaeg
Resistomes with Sequence VariantsHaemophilus influenzaeg+wgs
Classification8 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ multidrug and toxic compound extrusion (MATE) transporter [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Publications

Piddock LJ. 2006. Clin Microbiol Rev 19(2): 382-402. Clinically relevant chromosomally encoded multidrug resistance efflux pumps in bacteria. (PMID 16614254)

Xu XJ, et al. 2003. Microbiol. Immunol. 47(12):937-43 Molecular cloning and characterization of the HmrM multidrug efflux pump from Haemophilus influenzae Rd. (PMID 14695443)

Resistomes

Prevalence of hmrM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Haemophilus influenzae97.89%0%96.45%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 900


>gb|ADO96486.1|-|hmrM [Haemophilus influenzae R2846]
MNFRLLSQYHTDIKKLIKISLPILLAQIAQNSMGLADTIMAGRVSSTDMAAISIGASIWMPLMFFGQGLLLALPPTISYLNGSGQHHRIA
HQVRQGIWLVLGVSIPLGLLIYFCEIPLQYMQMESKMSDLARNYLHAMLWGLPAYLMLINFRCLNDGIEKTKPAMVITFLGLLINIPLNY
IFIYGKFGMPAFGAVGCGIATAIVNWAMCLMMIFYSYTNTQERSLKVFSQLIEMPNPKTLKKLLRLGLPIAIAICCEVALYALTSLMLSP
LGATIVASHQITLNTSSFIFMFPMSIGMATTILVGQALGAGSPQNAKKIGYAALLLGLTVTIVTALITIFFRYEIASIFVTDEIVIAMAA
NLLLFAALYQFSDTIQMVVGGILRGYKDTKVILYITLFSYWVIGVPLGYTLGRTDWLVPHIDAKGFWIAFVVSLTFAAFLLSLRMKKMQA
MNDNAILQRLEKLK


>gb|CP002276.1|-|1144674-1146068|hmrM [Haemophilus influenzae R2846]
ATGAATTTTCGTCTTTTATCTCAATACCACACTGATATTAAAAAGTTGATTAAAATTTCCTTGCCTATTTTATTAGCGCAAATTGCACAA
AACTCAATGGGATTAGCGGATACCATTATGGCGGGGCGAGTGAGTTCCACTGATATGGCAGCCATTTCTATTGGTGCTTCAATTTGGATG
CCATTGATGTTTTTTGGGCAAGGTTTATTGTTGGCATTGCCGCCTACAATTTCTTATTTGAATGGTTCAGGCCAACACCATCGCATTGCA
CATCAAGTTCGCCAAGGCATTTGGCTTGTGTTAGGCGTGAGTATTCCTTTAGGTTTACTGATTTATTTCTGTGAAATTCCGCTGCAATAT
ATGCAAATGGAAAGCAAAATGTCAGATTTAGCACGCAATTATTTACACGCGATGTTGTGGGGATTGCCAGCTTATTTGATGCTGATTAAT
TTTCGTTGTTTAAATGATGGGATTGAGAAAACCAAGCCTGCGATGGTCATTACCTTTTTAGGTTTATTGATTAATATTCCGCTTAATTAC
ATTTTTATTTATGGAAAATTTGGTATGCCTGCTTTTGGTGCGGTGGGCTGTGGTATTGCGACAGCTATTGTGAACTGGGCAATGTGCTTA
ATGATGATTTTCTATTCCTACACGAATACTCAAGAACGTTCACTAAAAGTATTTAGTCAATTAATTGAAATGCCAAATCCGAAAACACTT
AAAAAATTACTGCGTTTAGGATTACCCATTGCCATTGCAATTTGTTGCGAAGTGGCGTTATATGCACTTACGTCCTTAATGCTTTCTCCG
CTGGGTGCAACTATTGTGGCAAGCCATCAAATTACGCTGAATACTAGTTCTTTTATTTTTATGTTCCCTATGTCGATTGGTATGGCAACG
ACGATTTTAGTTGGACAAGCATTGGGTGCAGGTTCTCCACAAAATGCGAAGAAAATTGGCTATGCCGCATTATTATTAGGGCTAACTGTG
ACAATTGTTACTGCATTAATTACGATTTTTTTCCGTTATGAAATTGCATCGATCTTCGTGACAGATGAAATTGTCATCGCCATGGCAGCA
AATCTATTATTATTTGCCGCACTTTATCAATTTTCAGATACCATTCAAATGGTGGTTGGTGGTATTTTACGTGGTTATAAAGATACTAAA
GTCATTTTATACATTACCCTTTTCTCTTATTGGGTAATTGGTGTGCCACTTGGTTATACGCTAGGTCGTACAGATTGGCTTGTGCCACAC
ATTGATGCGAAAGGTTTCTGGATTGCCTTTGTGGTCTCGCTCACTTTTGCGGCATTCTTACTTTCTTTGAGAATGAAAAAAATGCAAGCT
ATGAACGACAACGCTATTTTACAACGTTTAGAAAAACTTAAATAA