lnuG

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004085
CARD Short NamelnuG
DefinitionlnuG is a transposon-mediated lincosamide nucleotidyltransferase found in Enterococcus faecalis on Tn6260.
AMR Gene Familylincosamide nucleotidyltransferase (LNU)
Drug Classlincosamide antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ lincosamide nucleotidyltransferase (LNU) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter johnsoniip+wgs, Acinetobacter lwoffiiwgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+wgs, Escherichia colip+wgs, Klebsiella pneumoniaewgs, Ligilactobacillus animaliswgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs, Proteus vulgariswgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Salmonella entericawgs, Serratia marcescenswgs
Resistomes with Sequence VariantsAcinetobacter johnsoniip+wgs, Acinetobacter lwoffiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniip, Enterobacter cloacaep, Enterobacter hormaecheip+wgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+wgs, Enterococcus hiraewgs, Escherichia colip+wgs, Escherichia fergusoniip+wgs, Jeotgalibaca porcig, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep, Ligilactobacillus animaliswgs, Listeria monocytogeneswgs, Morganella morganiig+wgs, Proteus mirabilisg+p+wgs, Proteus vulgariswgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Salmonella entericawgs, Serratia marcescenswgs, Staphylococcus aureusg+wgs, Staphylococcus simulanswgs
Publications

Zhu XQ, et al. 2017. J. Antimicrob. Chemother. 72(4):993-997 Novel lnu(G) gene conferring resistance to lincomycin by nucleotidylation, located on Tn6260 from Enterococcus faecalis E531. (PMID 28039271)

Resistomes

Prevalence of lnuG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter johnsonii0%1.39%1.82%0%0%
Acinetobacter lwoffii0%0%2.63%0%0%
Citrobacter portucalensis0%0%2.7%0%0%
Citrobacter werkmanii0%10%0%0%0%
Enterobacter cloacae0%0.56%0%0%0%
Enterobacter hormaechei0%0.06%0.04%0%0%
Enterococcus faecalis5%0.49%1.35%0%0%
Enterococcus faecium1.27%0%2.17%0%0%
Enterococcus hirae0%0%1.85%0%0%
Escherichia coli0%0.12%0.94%0%0.22%
Escherichia fergusonii0%0.36%1.09%0%0%
Jeotgalibaca porci100%0%0%0%0%
Klebsiella pneumoniae0%0.03%0.06%0%0%
Klebsiella quasipneumoniae0%0.21%0%0%0%
Ligilactobacillus animalis0%0%8.33%0%0%
Listeria monocytogenes0%0%0.02%0%0%
Morganella morganii1.92%0%1.84%0%0%
Proteus mirabilis1.83%1.25%10.89%0%0%
Proteus vulgaris0%0%5.56%0%0%
Providencia rettgeri0%0%7.01%0%0%
Providencia stuartii0%0%9.09%0%0%
Salmonella enterica0%0%0.29%0%0%
Serratia marcescens0%0%0.13%0%0%
Staphylococcus aureus0.09%0%0.26%0%0%
Staphylococcus simulans0%0%3.39%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|APU52409.1|+|lnuG [Enterococcus faecalis]
MLKQKELMARVKELVQSDERISACMMYGSFTKGEGDQYSDIEYYVFLKDDTISTFDSAKWLNEVASYTLLYQNEYGTEVVIFENLIRGEF
HFLSENEMNIIPSFKESGYIPDTKAMFIYDETGQLELYLSELEGPGPNRLTEENVNFLLNNFSNLWLMGINVLKRGENARSLELLSQLQK
NILQLIRIAEENADNWFNMTKNLEKEISPENYEKFKKTTARLNELELYEAYKNSLLLVMELRNLVEKQYQLTISDDFLGKLFNYMNE


>gb|KX470419.1|+|3812-4615|lnuG [Enterococcus faecalis]
TTGTTAAAACAAAAGGAACTAATGGCAAGGGTTAAGGAACTTGTCCAGTCAGATGAACGAATATCTGCTTGTATGATGTATGGCTCTTTT
ACAAAAGGAGAGGGAGATCAATACTCTGATATAGAATATTACGTTTTTCTAAAAGATGATACAATTTCCACCTTTGATTCAGCAAAATGG
CTAAATGAAGTCGCTTCCTACACTTTACTCTATCAAAATGAGTACGGTACGGAAGTAGTAATTTTTGAAAATCTAATACGTGGTGAATTT
CATTTCCTTTCCGAAAACGAAATGAATATTATTCCTTCATTCAAAGAATCAGGCTACATTCCTGACACAAAAGCAATGTTTATTTATGAT
GAAACAGGACAACTAGAATTGTATTTATCAGAGTTGGAAGGTCCGGGACCAAATAGACTTACAGAAGAAAACGTAAATTTTTTATTGAAT
AATTTTTCCAACCTATGGTTAATGGGGATTAATGTTCTTAAAAGAGGGGAAAATGCACGTTCACTGGAACTTTTATCTCAATTACAAAAA
AATATACTACAACTCATTCGAATTGCGGAAGAAAATGCCGATAATTGGTTTAATATGACAAAGAATCTTGAAAAAGAAATTAGTCCTGAA
AACTATGAAAAGTTTAAAAAGACTACTGCCCGATTAAATGAATTAGAACTATATGAAGCCTATAAGAACTCTTTGCTTCTCGTTATGGAA
CTTCGAAATCTCGTTGAAAAACAGTATCAATTAACCATTAGCGATGATTTTTTAGGCAAACTGTTTAATTATATGAACGAATAA

Curator Acknowledgements
Curator Description Most Recent Edit