ANT(3'')-IIa

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004089
Synonym(s)aadA1-pm ANT(9)(3'')
CARD Short NameANT(3'')-IIa
DefinitionANT(3'')-IIa is a aminoglycoside nucleotidyltransferase identified in Acinetobacter spp. via horizontal gene transfer mechanisms.
AMR Gene FamilyANT(3'')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification10 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic spectinomycin [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ ANT(3'') [AMR Gene Family]
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter pittiiwgs, Aeromonas caviaewgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniiwgs, Alcaligenes faecalisg, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Deinococcus radioduransp, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs, Neisseria brasiliensisg, Proteus mirabilisp+wgs, Proteus vulgarisp+wgs, Providencia alcalifaciensg, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidap, Raoultella planticolawgs, Riemerella anatipestiferwgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shewanella putrefaciensg+p, Shigella flexnerip, Shigella sonneiwgs, Stutzerimonas stutzeriwgs, Vibrio alginolyticuswgs, Vibrio choleraeg+wgs, Vibrio fluvialiswgs, Vibrio parahaemolyticuswgs, Yersinia enterocoliticawgs
Publications

Zhang G, et al. 2017. PLoS Genet. 13(2):e1006602 A new subclass of intrinsic aminoglycoside nucleotidyltransferases, ANT(3'')-II, is horizontally transferred among Acinetobacter spp. by homologous recombination. (PMID 28152054)

Resistomes

Prevalence of ANT(3'')-IIa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.35%0.05%1.5%0%0%
Acinetobacter pittii0%0%0.28%0%0%
Aeromonas caviae0%0%5.38%0%0%
Aeromonas hydrophila3.08%2.6%0.81%0%0%
Aeromonas veronii0%0%2.81%0%0%
Alcaligenes faecalis5%0%0%0%0%
Citrobacter freundii0%0.31%4.84%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%2.94%1.8%0%0%
Citrobacter werkmanii0%0%10.26%0%0%
Citrobacter youngae0%0%12.5%0%0%
Deinococcus radiodurans0%3.7%0%0%0%
Enterobacter asburiae0%0%3.95%0%0%
Enterobacter chengduensis0%0%12%0%0%
Enterobacter cloacae0%2.23%4.79%0%0%
Enterobacter hormaechei0%1.35%8.16%0%0%
Enterobacter kobei0%0.69%3.93%0%0%
Enterobacter roggenkampii0%0%1.8%0%0%
Escherichia coli0.02%0.57%1.8%0%0%
Escherichia fergusonii0%1.07%3.26%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis0%1.14%1.33%0%0%
Klebsiella oxytoca0%2.74%5.88%0%0%
Klebsiella pneumoniae0.06%0.54%5.01%0%0%
Klebsiella quasipneumoniae0%0.42%6.45%0%0%
Leclercia adecarboxylata0%0%2.33%0%0%
Morganella morganii1.92%0%3.07%0%0%
Neisseria brasiliensis100%0%0%0%0%
Proteus mirabilis0%3.75%3.8%0%0%
Proteus vulgaris0%22.22%11.11%0%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia rettgeri0%0%24.84%0%0%
Providencia stuartii0%13.64%4.55%0%0%
Pseudomonas aeruginosa2.91%0.58%2.09%0%0%
Pseudomonas putida0%4%0%0%0%
Raoultella planticola0%0%2.56%0%0%
Riemerella anatipestifer0%0%0.69%0%0%
Salmonella enterica0%0.98%2.82%0%0%
Serratia marcescens0%1.29%1.83%0%0%
Shewanella putrefaciens11.11%20%0%0%0%
Shigella flexneri0%1.61%0%0%0%
Shigella sonnei0%0%0.58%0%0%
Stutzerimonas stutzeri0%0%6.11%0%0%
Vibrio alginolyticus0%0%0.4%0%0%
Vibrio cholerae0.45%0%1.92%0%0%
Vibrio fluvialis0%0%20%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Yersinia enterocolitica0%0%0.45%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|EEX02086.1|-|ANT(3'')-IIa [Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841]
MPDFIQLEYLQEKLQQLLAESLFAIYLYGSAVDGGLGPESDLDVLVVVTQPLTSALREQLAQELLKISQPVGELQRPLEVTILLKDEIQA
GNYPLSYEMQFGEWLREELKEGGTLSSQKDPDISILLRKARFHHTVLFGPALDQWAPEISDQELWQAMSDTYPEIVAHWDEDADERNQIL
ALCRIYFSLVMKDIASKDNAARWVMPQLPPEQKFVLQRLIQEYRGEIGKQNWQEEHYALQPIVNFLSSKIEEQFEQKRNLIT


>gb|GG704579.1|-|34581-35369|ANT(3'')-IIa [Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841]
ATGCCTGATTTCATTCAGTTAGAATATCTACAAGAAAAATTACAGCAACTTTTAGCGGAATCATTATTTGCAATCTATCTTTATGGTTCA
GCTGTTGATGGTGGCTTAGGGCCAGAAAGTGACCTTGATGTTCTGGTCGTGGTTACTCAACCATTAACATCTGCTTTACGCGAGCAGCTT
GCACAAGAATTACTAAAAATTTCACAGCCTGTTGGGGAATTACAAAGACCATTAGAAGTTACTATTTTATTAAAAGATGAGATTCAGGCT
GGAAATTATCCTTTAAGTTATGAAATGCAGTTTGGTGAATGGCTACGTGAAGAACTTAAAGAAGGTGGAACATTAAGTTCGCAGAAAGAC
CCAGATATTAGTATATTGCTTAGAAAAGCGAGATTTCATCATACAGTTTTATTTGGTCCAGCTTTGGACCAATGGGCACCTGAAATTTCT
GATCAAGAACTATGGCAAGCAATGTCTGATACTTATCCCGAAATTGTAGCTCATTGGGATGAGGATGCAGATGAAAGAAACCAGATTTTA
GCTTTATGCCGGATCTATTTTAGTTTAGTCATGAAGGATATTGCTTCAAAAGACAATGCAGCTCGATGGGTTATGCCTCAGCTTCCTCCT
GAGCAGAAATTCGTATTGCAGCGGCTTATACAGGAATATAGAGGGGAAATAGGCAAACAAAATTGGCAAGAGGAACATTATGCTTTGCAG
CCTATTGTTAATTTTCTGAGTTCAAAAATTGAAGAGCAGTTTGAGCAGAAAAGAAATTTGATCACATAA

Curator Acknowledgements
Curator Description Most Recent Edit