Enterococcus faecium chloramphenicol acetyltransferase

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004456
CARD Short NameEfac_ACT_CHL
DefinitionA chloramphenicol resistance determinant described in an Enterococcus faecium plasmid.
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Resistomes with Perfect MatchesBrevibacillus laterosporuswgs, Enterococcus faecaliswgs, Enterococcus faeciump+wgs, Staphylococcus arlettaewgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidiswgs, Staphylococcus haemolyticuswgs, Staphylococcus saprophyticuswgs
Resistomes with Sequence VariantsBrevibacillus laterosporuswgs, Enterococcus faecaliswgs, Enterococcus faeciump+wgs, Staphylococcus arlettaewgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitiswgs, Staphylococcus epidermidiswgs, Staphylococcus equorumwgs, Staphylococcus haemolyticuswgs, Staphylococcus saprophyticuswgs
Publications

Grady R, et al. 2003. Mol Microbiol 47(5): 1419-1432. Axe-Txe, a broad-spectrum proteic toxin-antitoxin system specified by a multidrug-resistant, clinical isolate of Enterococcus faecium. (PMID 12603745)

Resistomes

Prevalence of Enterococcus faecium chloramphenicol acetyltransferase among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Brevibacillus laterosporus0%0%2.94%0%0%
Enterococcus faecalis0%0%0.66%0%0%
Enterococcus faecium0%0.19%0.61%0%0%
Staphylococcus arlettae0%0%7.5%0%0%
Staphylococcus aureus0.61%0.04%0.53%0%0%
Staphylococcus capitis0%0%1.9%0%0%
Staphylococcus epidermidis0%0%0.33%0%0%
Staphylococcus equorum0%0%1.79%0%0%
Staphylococcus haemolyticus0%0%1.32%0%0%
Staphylococcus saprophyticus0%0%3.5%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|AAO52851.1|+|Enterococcus faecium chloramphenicol acetyltransferase [Enterococcus faecium]
MTFNIINLETWDRKEYFNHYFNQQTTYSVTKELDITLLKSMIKDKGYELYPALIHAIVSVINRNKVFRTGINSEGNLGYWDKLEPLYTVF
NKETEKFSNIWTESNASFNSFYNSYKNDLFKYKDKNEMFPKKPIPENTVPISMIPWIDFSSFNLNIGNNSRFLLPIITIGKFYSKDDKIY
LPFSLQVHHAVCDGYHVSLFMNEFQNIIDNVNEWI


>gb|AF507977.1|+|17464-18111|Enterococcus faecium chloramphenicol acetyltransferase [Enterococcus faecium]
ATGACTTTTAATATTATTAATTTAGAAACTTGGGATAGAAAAGAATATTTCAATCATTATTTTAATCAACAAACAACTTATAGTGTTACT
AAAGAATTAGATATTACCTTGTTAAAAAGTATGATAAAAGATAAAGGATATGAACTGTATCCTGCTTTGATTCATGCAATTGTAAGTGTT
ATAAATCGAAATAAAGTATTTAGAACAGGGATTAATAGTGAGGGGAATTTGGGTTATTGGGATAAATTAGAACCTTTATATACAGTCTTT
AATAAAGAAACTGAAAAATTTTCTAATATTTGGACAGAATCAAATGCTAGTTTTAACTCTTTTTATAATAGTTATAAGAATGATTTATTT
AAATATAAAGATAAAAATGAAATGTTTCCTAAAAAGCCGATACCTGAAAACACAGTTCCTATCTCGATGATTCCTTGGATTGATTTTAGT
TCATTTAATTTAAATATTGGTAATAATAGTAGATTTTTATTGCCAATTATTACAATAGGTAAATTTTATAGTAAGGATGATAAGATCTAT
TTACCATTTTCATTGCAAGTTCATCATGCAGTATGTGATGGTTACCATGTTTCATTATTTATGAATGAATTTCAAAATATAATTGATAAT
GTAAATGAATGGATTTAA

Curator Acknowledgements
Curator Description Most Recent Edit