Enterococcus faecium chloramphenicol acetyltransferase

Accession ARO:3004456
DefinitionA chloramphenicol resistance determinant described in an Enterococcus faecium plasmid
AMR Gene Familychloramphenicol acetyltransferase (CAT)
Drug Classphenicol antibiotic
Resistance Mechanismantibiotic inactivation
ResistomesChlamydia trachomatiswgs, Enterococcus faecaliswgs, Enterococcus faeciump+wgs, Staphylococcus aureusg+wgs, Staphylococcus epidermidiswgs
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ chloramphenicol acetyltransferase (CAT) [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Publications

Grady R, et al. 2003. Mol Microbiol 47(5): 1419-1432. Axe-Txe, a broad-spectrum proteic toxin-antitoxin system specified by a multidrug-resistant, clinical isolate of Enterococcus faecium. (PMID 12603745)

Resistomes

Prevalence of Enterococcus faecium chloramphenicol acetyltransferase among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Chlamydia trachomatis0%0%2.38%
Enterococcus faecalis0%0%1.55%
Enterococcus faecium0%0.35%0.92%
Staphylococcus aureus0.24%0%0.45%
Staphylococcus epidermidis0%0%0.37%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 350


>gb|AAO52851.1|+|Enterococcus faecium chloramphenicol acetyltransferase [Enterococcus faecium]
MTFNIINLETWDRKEYFNHYFNQQTTYSVTKELDITLLKSMIKDKGYELYPALIHAIVSVINRNKVFRTGINSEGNLGYWDKLEPLYTVF
NKETEKFSNIWTESNASFNSFYNSYKNDLFKYKDKNEMFPKKPIPENTVPISMIPWIDFSSFNLNIGNNSRFLLPIITIGKFYSKDDKIY
LPFSLQVHHAVCDGYHVSLFMNEFQNIIDNVNEWI


>gb|AF507977.1|+|17464-18111|Enterococcus faecium chloramphenicol acetyltransferase [Enterococcus faecium]
ATGACTTTTAATATTATTAATTTAGAAACTTGGGATAGAAAAGAATATTTCAATCATTATTTTAATCAACAAACAACTTATAGTGTTACT
AAAGAATTAGATATTACCTTGTTAAAAAGTATGATAAAAGATAAAGGATATGAACTGTATCCTGCTTTGATTCATGCAATTGTAAGTGTT
ATAAATCGAAATAAAGTATTTAGAACAGGGATTAATAGTGAGGGGAATTTGGGTTATTGGGATAAATTAGAACCTTTATATACAGTCTTT
AATAAAGAAACTGAAAAATTTTCTAATATTTGGACAGAATCAAATGCTAGTTTTAACTCTTTTTATAATAGTTATAAGAATGATTTATTT
AAATATAAAGATAAAAATGAAATGTTTCCTAAAAAGCCGATACCTGAAAACACAGTTCCTATCTCGATGATTCCTTGGATTGATTTTAGT
TCATTTAATTTAAATATTGGTAATAATAGTAGATTTTTATTGCCAATTATTACAATAGGTAAATTTTATAGTAAGGATGATAAGATCTAT
TTACCATTTTCATTGCAAGTTCATCATGCAGTATGTGATGGTTACCATGTTTCATTATTTATGAATGAATTTCAAAATATAATTGATAAT
GTAAATGAATGGATTTAA