Acinetobacter baumannii AmvA

Accession ARO:3004577
Synonym(s)B0V737
DefinitionAmvA has 14 alpha-helical transmembrane segments, qualifying it as a member of the DHA2 transporter family of the major facilitator superfamily (MFS). When AmvA was expressed in E. coli, the cells had at least four-fold decreased susceptibility to erythromycin, acridine orange, acriflavine, deoxycholate and methyl viologen. AmvA from the AC0037 strain of A. baumannii was tested.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, glycylcycline, acridine dye, nucleoside antibiotic, macrolide antibiotic, bicyclomycin, nitroimidazole antibiotic, oxazolidinone antibiotic, peptide antibiotic, rhodamine, lincosamide antibiotic, diaminopyrimidine antibiotic, antibacterial free fatty acids, penam, benzalkonium chloride, isoniazid, phenicol antibiotic, rifamycin antibiotic, fluoroquinolone antibiotic, fosfomycin, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesAcinetobacter baumanniig+wgs
Classification30 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

Rajamohan G, et al. 2010. J. Antimicrob. Chemother. 65(9):1919-25 Molecular and functional characterization of a novel efflux pump, AmvA, mediating antimicrobial and disinfectant resistance in Acinetobacter baumannii. (PMID 20573661)

Resistomes

Prevalence of Acinetobacter baumannii AmvA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii99.36%0%99.65%
Acinetobacter haemolyticus25%0%50%
Acinetobacter nosocomialis100%0%100%
Staphylococcus aureus0%0%0.03%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 600


>gb|ACQ82816.1|+|Acinetobacter baumannii AmvA [Acinetobacter baumannii]
MQKKWLILTIIVLIYLPVTIDATVMHVATPSLSAALNLTANQLLWIIDIYSLIMAGLILPMGALGDRIGFKKLLFIGTAVFGVGSLAAAF
SPTAYALIASRAILGLGAAMLIPATLSGIRNAFTEEKQRNFALGIWSTVGGGGAAFGPLVGGFVLEHFHWGAVFLINIPIILAVLVMIVM
IIPKQQEKTDQPINLGQALVLVVAILSLIYSIKSAMYNFSVLTVVMFVVGISTLIHFIRSQKRATTPMIDLELFKHPVISTSIVMAVVSM
IALVGFELLLSQELQFVHGFSPLQAAMFIIPFMIAISLGGPLAGICLNKWGLRRVSSLGILVSALSLWGLAQLNFSTDHFLAWTCMVFLG
FSIEIALLASTAAIMSSVPPQKASAAGAIEGMAYELGAGLGVAIFGLMLSWFYSRSIILPAELPSNLIEKASISIGETMQLASNLENPLG
GQLIVVAQQAFSYAHSWVLTLSAICFFLLTVFVWFSFPKKVN


>gb|FJ911554.1|+|177-1655|Acinetobacter baumannii AmvA [Acinetobacter baumannii]
ATGCAAAAAAAATGGTTAATCCTGACAATTATCGTCCTCATTTATTTACCAGTTACGATTGATGCAACGGTGATGCATGTTGCAACACCA
TCTTTAAGTGCAGCATTGAATTTAACTGCCAATCAGCTTTTATGGATTATTGATATTTATTCGCTGATTATGGCGGGTTTGATTTTGCCG
ATGGGTGCACTCGGTGATCGTATTGGCTTTAAAAAATTATTATTTATTGGAACCGCAGTTTTTGGTGTGGGTTCGTTAGCTGCGGCTTTT
TCTCCAACTGCCTATGCCTTAATTGCTTCTCGTGCTATTTTAGGCCTAGGGGCAGCTATGCTTATTCCTGCCACTTTATCCGGTATCCGT
AATGCTTTTACCGAAGAAAAGCAGAGAAATTTTGCACTTGGTATTTGGTCTACAGTAGGTGGAGGTGGAGCAGCTTTTGGTCCATTAGTC
GGTGGTTTTGTATTAGAACACTTCCATTGGGGAGCTGTATTCCTCATTAATATCCCGATTATTTTAGCCGTTCTAGTTATGATCGTGATG
ATCATTCCTAAACAACAAGAGAAAACTGATCAGCCAATTAACTTAGGGCAAGCTTTAGTTTTGGTTGTAGCAATTTTAAGCCTCATCTAT
TCAATTAAATCGGCTATGTATAACTTTTCGGTGCTCACGGTTGTGATGTTTGTGGTGGGTATAAGCACATTAATTCACTTCATTCGAAGC
CAAAAAAGAGCTACGACACCAATGATTGATCTGGAGTTATTTAAACATCCAGTAATTTCTACAAGTATTGTTATGGCTGTTGTTTCCATG
ATTGCTTTGGTTGGCTTTGAATTATTACTGTCTCAAGAGTTGCAGTTTGTACACGGGTTTTCTCCATTACAGGCGGCGATGTTTATTATT
CCATTTATGATTGCAATTAGTTTAGGTGGTCCATTAGCAGGTATTTGTTTAAATAAATGGGGTTTACGTAGAGTATCGAGCCTAGGTATT
TTAGTGAGCGCGCTCAGTTTATGGGGGCTTGCTCAGCTTAATTTTTCAACCGACCACTTTTTAGCATGGACATGTATGGTCTTTTTGGGC
TTTAGCATTGAGATTGCCTTACTTGCCTCAACTGCTGCCATTATGTCATCTGTGCCCCCTCAAAAGGCGAGTGCAGCAGGTGCTATTGAG
GGAATGGCCTATGAGCTTGGCGCTGGCTTAGGTGTTGCTATTTTTGGTTTAATGTTGTCTTGGTTTTATAGCCGCTCAATTATTTTGCCA
GCCGAGCTTCCGTCAAACTTAATTGAAAAAGCGAGTATCTCGATTGGAGAAACCATGCAATTAGCCTCTAATCTTGAAAATCCTTTAGGA
GGGCAATTAATTGTAGTGGCGCAGCAAGCTTTTAGCTATGCCCATAGTTGGGTACTTACCCTCTCAGCGATCTGTTTCTTCCTTTTAACT
GTATTTGTCTGGTTTAGTTTTCCGAAGAAAGTAAATTAA