aadS

Download Sequences

Accession	ARO:3004683
CARD Short Name	aadS
Definition	A novel Tn4551 streptomycin-resistance gene that was phenotypically silent in wild-type Bacteroides; expression could be activated by a trans-acting chromosomal mutation.
AMR Gene Family	ANT(6)
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Bacteroides caccae^wgs, Bacteroides fragilis^g+wgs, Bacteroides ovatus^p+wgs, Bacteroides thetaiotaomicron^g+p+wgs, Elizabethkingia anophelis^g+wgs, Myroides odoratimimus^g+p+wgs, Myroides phaeus^g, Parabacteroides distasonis^g+wgs, Phocaeicola dorei^wgs, Phocaeicola massiliensis^wgs, Phocaeicola vulgatus^wgs, Riemerella anatipestifer^g+p+wgs, Sphingobacterium hotanense^g
Resistomes with Sequence Variants	Bacteroides caccae^wgs, Bacteroides fragilis^g+wgs, Bacteroides ovatus^p+wgs, Bacteroides thetaiotaomicron^g+p+wgs, Chryseobacterium taklimakanense^wgs, Elizabethkingia anophelis^g+wgs, Elizabethkingia miricola^wgs, Myroides odoratimimus^g+p+wgs, Myroides phaeus^g+wgs, Parabacteroides distasonis^g+wgs, Phocaeicola dorei^wgs, Phocaeicola massiliensis^wgs, Phocaeicola vulgatus^wgs, Riemerella anatipestifer^g+p+wgs, Sphingobacterium hotanense^g
Classification	11 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + nucleotidylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside nucleotidyltransferase (ANT) + aminoglycoside antibiotic [Drug Class] + ANT(6) [AMR Gene Family]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic streptomycin [Antibiotic] + ANT(6)-I
Publications	Smith CJ, et al. 1992. Mol. Microbiol. 6(16):2287-97 Activation of a cryptic streptomycin-resistance gene in the Bacteroides erm transposon, Tn4551. (PMID 1328814)

Resistomes

Prevalence of aadS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Bacteroides caccae	0%	0%	5%	0%	0%
Bacteroides caccae	0%	0%	5%	0%	0%
Bacteroides fragilis	7.69%	0%	2.65%	0%	0%
Bacteroides fragilis	7.69%	0%	2.65%	0%	0%
Bacteroides ovatus	0%	2.94%	6.84%	0%	0%
Bacteroides ovatus	0%	2.94%	6.84%	0%	0%
Bacteroides thetaiotaomicron	17.86%	2.27%	11.89%	0%	0%
Bacteroides thetaiotaomicron	17.86%	2.27%	11.89%	0%	0%
Chryseobacterium taklimakanense	0%	0%	0%	0%	0%
Chryseobacterium taklimakanense	0%	0%	50%	0%	0%
Elizabethkingia anophelis	7.69%	0%	13.4%	0%	0%
Elizabethkingia anophelis	7.69%	0%	22.68%	0%	0%
Elizabethkingia miricola	0%	0%	4.35%	0%	0%
Elizabethkingia miricola	0%	0%	0%	0%	0%
Myroides odoratimimus	50%	50%	7.14%	0%	0%
Myroides odoratimimus	50%	50%	7.14%	0%	0%
Myroides phaeus	100%	0%	0%	0%	0%
Myroides phaeus	100%	0%	100%	0%	0%
Parabacteroides distasonis	11.54%	0%	2.34%	0%	0%
Parabacteroides distasonis	11.54%	0%	2.34%	0%	0%
Phocaeicola dorei	0%	0%	13.54%	0%	0%
Phocaeicola dorei	0%	0%	13.54%	0%	0%
Phocaeicola massiliensis	0%	0%	15.38%	0%	0%
Phocaeicola massiliensis	0%	0%	15.38%	0%	0%
Phocaeicola vulgatus	0%	0%	8.08%	0%	0%
Phocaeicola vulgatus	0%	0%	8.08%	0%	0%
Riemerella anatipestifer	55.56%	7.69%	27.08%	0%	0%
Riemerella anatipestifer	69.44%	7.69%	34.72%	0%	0%
Sphingobacterium hotanense	100%	0%	0%	0%	0%
Sphingobacterium hotanense	100%	0%	0%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AAA27459.1|+|aadS [Transposon Tn4551]
MKVREEKLRTIIEWSEKNEDVRVLLLTSSLVNPLALVDEFSDLDIEFVFEDNTNYISDKSWTLKFGNPIAMIEEDESCFNHKHAMKMLLY
EDGVKVDFKLYSKSKFIKETQEKELPEDWDIGYKILIDKDGITKQMLKPTYQISIIKKPSEKEFQNLINDFWWDTTYVAKCLVRDEIFYA
KFMSETVIRTEYLIPLIEWHIASEHNWNITTNKYGRLFKKYLNQEMWAKTEQTFSGSDIKENWTALFSMTDLVSEIGTELSKKLEYKYPD
KLENDIRKYLAGLKPKT

>gb|M72415.1|+|1121-1984|aadS [Transposon Tn4551]
ATGAAAGTCAGAGAAGAAAAGTTAAGAACAATTATAGAATGGTCGGAGAAAAACGAAGATGTAAGAGTTCTTCTTCTGACAAGTTCACTT
GTAAATCCTTTAGCACTTGTTGACGAATTTAGTGATTTAGACATTGAATTTGTTTTTGAGGATAATACAAATTACATTTCAGACAAAAGC
TGGACGCTTAAATTCGGAAATCCAATTGCTATGATTGAAGAAGACGAAAGTTGTTTTAACCATAAACACGCAATGAAAATGCTACTTTAT
GAAGACGGTGTGAAAGTAGATTTTAAACTTTACAGCAAATCAAAATTTATAAAGGAAACGCAAGAGAAAGAATTACCAGAAGATTGGGAT
ATTGGCTATAAAATTTTAATTGATAAAGATGGTATTACAAAGCAAATGCTGAAACCAACTTATCAAATTTCCATTATCAAAAAACCGTCT
GAAAAAGAGTTTCAAAATCTAATAAACGATTTTTGGTGGGACACAACTTACGTGGCAAAGTGTCTTGTGAGAGATGAAATATTCTATGCG
AAATTTATGTCGGAAACCGTTATTCGCACAGAATATTTAATTCCTTTAATTGAATGGCACATTGCAAGTGAACACAATTGGAACATAACG
ACCAATAAATATGGACGGCTTTTCAAAAAGTATCTTAACCAGGAAATGTGGGCTAAAACAGAACAAACATTTTCAGGGAGCGATATAAAG
GAAAATTGGACTGCTCTATTTTCAATGACTGATTTAGTTTCAGAAATAGGAACTGAATTGTCAAAAAAATTAGAGTACAAATACCCGGAT
AAATTAGAAAATGACATACGAAAATATTTAGCTGGACTAAAACCCAAAACATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

aadS

Prevalence: protein homolog model (view sequences)

Graph