BAT-1

Accession ARO:3004747
DefinitionBAT-1 is a class D beta-lactamase found in Bacillus atrophaeus.
AMR Gene FamilyBAT Beta-lactamase
Drug Classcephalosporin
Resistance Mechanismantibiotic inactivation
Classification14 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ BAT Beta-lactamase [AMR Gene Family]
Publications

Gibbons HS, et al. 2011. PLoS ONE 6(3):e17836 Genomic signatures of strain selection and enhancement in Bacillus atrophaeus var. globigii, a historical biowarfare simulant. (PMID 21464989)

Liu F, et al. 2012. J. Bacteriol. 194(16):4454 Draft genome sequence of the sponge-associated strain Bacillus atrophaeus C89, a potential producer of marine drugs. (PMID 22843588)

Resistomes

Prevalence of BAT-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 550


>gb|EIM09515.1|+|BAT-1 [Bacillus atrophaeus C89]
MKKRKMPAVFLALIGAAGLLFTTSVQPISEASAAEKNLNIKKLDVDEFFADHNGTFILRDMNKGKTFIYNHERANQRFAPQSTFKVPNAL
IGLQVGAVEDEYSIKYWDGVKREIDIWNQDHTLGSGMRHSVVWYYQAMARDIGESRMKEWIEKISYGNQDISGGIDQFWLSSTLKISPIE
QADFMERLYKENLPFDKDVMKTVKRMMIQEEEDHSTLYGKTGSGTGIGWFFGFVKIDNRAYSFVTNIDGTGAEAKNITMDILKKYKLY


>gb|AJRJ01000061.1|+|17604-18410|BAT-1 [Bacillus atrophaeus C89]
ATGAAAAAACGCAAGATGCCAGCAGTTTTCTTAGCATTGATCGGTGCAGCCGGTCTATTATTTACTACAAGTGTACAGCCAATAAGCGAA
GCTAGTGCTGCCGAAAAGAATCTGAATATCAAAAAGCTCGATGTCGATGAATTTTTTGCCGATCATAACGGAACGTTTATATTACGTGAT
ATGAATAAAGGCAAAACATTTATCTATAATCATGAACGCGCCAACCAAAGATTTGCACCGCAATCGACTTTTAAAGTTCCTAATGCACTC
ATTGGCTTACAAGTAGGAGCTGTAGAAGATGAATATTCCATTAAATATTGGGATGGCGTGAAGCGGGAAATTGACATCTGGAATCAAGAT
CACACGCTTGGGTCTGGGATGAGGCATTCAGTTGTTTGGTATTATCAAGCGATGGCCCGTGACATTGGAGAAAGTCGAATGAAGGAATGG
ATCGAAAAAATTTCCTATGGCAACCAAGATATAAGCGGTGGAATTGACCAGTTTTGGTTAAGCAGCACACTCAAAATTTCTCCGATAGAA
CAAGCAGACTTTATGGAAAGATTGTATAAAGAGAACCTGCCTTTTGATAAGGATGTCATGAAAACAGTAAAACGGATGATGATTCAGGAG
GAAGAAGATCACTCTACTCTTTACGGAAAAACAGGTTCAGGGACAGGCATAGGGTGGTTTTTCGGTTTTGTGAAAATAGACAATCGAGCG
TATAGTTTTGTTACGAATATTGATGGAACAGGTGCAGAAGCTAAAAACATCACAATGGATATTTTAAAGAAATATAAGTTATATTAA