BPU-1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004759
CARD Short NameBPU-1
DefinitionBPU-1 is a class D beta-lactamase found in Bacillus pumilus.
AMR Gene FamilyBPU Beta-lactamase
Drug Classpenicillin beta-lactam
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ BPU Beta-lactamase [AMR Gene Family]
Resistomes with Perfect MatchesBacillus pumilusg+wgs
Resistomes with Sequence VariantsBacillus pumilusg+wgs
Publications

Gioia J, et al. 2007. PLoS ONE 2(9):e928 Paradoxical DNA repair and peroxide resistance gene conservation in Bacillus pumilus SAFR-032. (PMID 17895969)

Tirumalai MR, et al. 2013. PLoS ONE 8(6):e66012 Candidate genes that may be responsible for the unusual resistances exhibited by Bacillus pumilus SAFR-032 spores. (PMID 23799069)

Tirumalai MR, et al. 2013. Extremophiles 17(5):767-74 An ICEBs1-like element may be associated with the extreme radiation and desiccation resistance of Bacillus pumilus SAFR-032 spores. (PMID 23812891)

Stepanov VG, et al. 2016. PLoS ONE 11(6):e0157331 Bacillus pumilus SAFR-032 Genome Revisited: Sequence Update and Re-Annotation. (PMID 27351589)

Tirumalai MR, et al. 2018. BMC Microbiol. 18(1):57 Bacillus safensis FO-36b and Bacillus pumilus SAFR-032: a whole genome comparison of two spacecraft assembly facility isolates. (PMID 29884123)

Resistomes

Prevalence of BPU-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Bacillus pumilus50%0%87.71%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ABV63006.2|-|BPU-1 [Bacillus pumilus SAFR-032]
MKKKYIKRLFSCIMLMAFCISQPSSTEARSIAWSVDEFFKNREGTFVIQEVKEKSPWVYNKKRAKERFAPQSTFKVANALIGLQTGAVRD
EYDIKYWDGVKREIDNWNRDHTLGSGMRDSVVWYYQAMARDIGEERMNHWVKAIHYGNKDISGGIDQFWLSSTLRISPIEQVRFLKQLYE
ETLPFDLKNMRTVKRMMVQEEEKHATLYGKTGSGSDIGWYVGFIKHEHKTYILATNIKGTGIEAKDITYRILKKYHLMEASV


>gb|CP000813.4|-|2349399-2350187|BPU-1 [Bacillus pumilus SAFR-032]
TTGAAGAAAAAGTATATAAAAAGGCTGTTTTCTTGCATCATGCTGATGGCATTTTGTATCAGCCAGCCATCATCAACTGAAGCAAGATCA
ATAGCGTGGTCTGTAGATGAATTCTTTAAAAATCGGGAAGGCACGTTTGTGATTCAAGAAGTAAAAGAAAAGTCCCCATGGGTGTATAAC
AAAAAAAGAGCGAAAGAGCGCTTTGCACCTCAATCGACATTTAAGGTAGCAAATGCCTTAATCGGACTCCAAACAGGCGCAGTGAGAGAT
GAATACGACATCAAATATTGGGATGGCGTAAAAAGAGAGATTGACAATTGGAATAGAGATCATACATTAGGATCTGGCATGAGAGATTCA
GTCGTCTGGTACTATCAAGCCATGGCACGTGACATTGGAGAAGAACGCATGAATCATTGGGTGAAAGCTATTCATTATGGGAACAAAGAC
ATATCTGGCGGAATCGATCAATTTTGGTTAAGCAGTACCCTACGAATTTCTCCCATCGAACAAGTTCGTTTTCTCAAACAGCTATATGAA
GAGACTCTTCCATTTGACCTAAAGAACATGAGAACAGTCAAACGAATGATGGTACAAGAAGAAGAGAAACACGCCACCCTATACGGAAAA
ACAGGCTCCGGATCAGACATCGGCTGGTACGTAGGTTTTATCAAACATGAACACAAAACCTACATCCTCGCCACAAATATCAAAGGCACC
GGCATAGAAGCAAAAGACATCACCTATCGCATTTTGAAAAAATATCATTTGATGGAAGCATCCGTTTAG

Curator Acknowledgements
Curator Description Most Recent Edit