Neisseria gonorrhoeae folP with mutation conferring resistance to sulfonamides

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004873
CARD Short NameNgon_folP_SLF
DefinitionPoint mutations in Neisseria gonorrhoeae dihydropteroate synthase folP prevent sulfonamide antibiotics from inhibiting its role in folate synthesis, thus conferring sulfonamide resistance.
AMR Gene Familysulfonamide resistant dihydropteroate synthase folP
Drug Classsulfone antibiotic, sulfonamide antibiotic
Resistance Mechanismantibiotic target alteration
Classification23 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic sulfisoxazole [Antibiotic]
+ sulfonamide resistant dihydropteroate synthase folP [AMR Gene Family]
Publications

Sánchez-Busó L, et al. 2019. Nat Microbiol 4(11):1941-1950 The impact of antimicrobials on gonococcal evolution. (PMID 31358980)

Resistomes

Prevalence of Neisseria gonorrhoeae folP with mutation conferring resistance to sulfonamides among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 200

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
R228Ssingle resistance variantPMID:31358980

>gb|KAE9504908.1|+|Neisseria gonorrhoeae folP with mutation conferring resistance to sulfonamides [Neisseria gonorrhoeae]
MARHVWRAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAERLLKEGADILD
IGGESTRPGADFVPPEEEEWARVEPVLAEAAGWGVPVSLDTRRTVVMEKALALGGIDIIN
DVAALTDEGAVELLARQADTGICLMHMRGLPETMQDNPKYQDVVGEVARYLKTRSETCVA
AGIAPQRITLDPGFGFGKNLQHNIALMRHLPELMAETGLPLLIGVSRKRMIGELTGEADA
AARVHGSVAAALASVARGAQIVRVHDVKATADALKVWEALGVNR



>gb|WHPL01000002.1|+|1956331-1957185|Neisseria gonorrhoeae folP with mutation conferring resistance to sulfonamides [Neisseria gonorrhoeae]
ATGGCACGACACGTTTGGCGGGCAGGACGGTTTGAAATCGGTTTGGACAAACCGAAAATCATGGGCATCGTGAATCTCACGCCCGATTCT
TTTTCCGACGGCGGCGCGTATTCGCAAAACGCCCAAACAGCTTTGGCGCATGCCGAACGGCTTTTGAAAGAGGGTGCGGACATTCTCGAC
ATCGGCGGCGAATCGACGCGGCCGGGTGCGGATTTCGTTCCGCCCGAAGAAGAAGAATGGGCGCGGGTTGAGCCTGTATTGGCGGAAGCG
GCGGGGTGGGGCGTTCCCGTCAGTTTGGACACGCGCCGCACGGTGGTTATGGAAAAGGCGTTGGCACTCGGCGGCATCGATATTATCAAT
GATGTGGCGGCGTTGACCGACGAAGGTGCGGTCGAATTGCTGGCGCGCCAGGCGGACACGGGCATTTGCCTGATGCATATGCGGGGCTTG
CCCGAAACCATGCAGGACAATCCGAAATATCAGGATGTGGTCGGCGAAGTGGCACGTTATCTGAAAACACGGTCAGAAACCTGTGTCGCG
GCAGGCATCGCGCCGCAACGGATTACGCTCGACCCGGGTTTCGGCTTCGGCAAGAACCTGCAACACAATATCGCACTGATGCGGCATTTG
CCCGAATTGATGGCGGAAACCGGTTTGCCGCTGCTGATCGGTGTGTCGCGCAAACGCATGATAGGTGAGCTGACCGGTGAGGCGGACGCG
GCGGCGCGCGTACACGGCAGCGTGGCAGCGGCTTTGGCTTCCGTGGCACGCGGAGCGCAAATCGTGCGCGTGCACGATGTGAAGGCGACG
GCGGACGCGTTGAAGGTGTGGGAAGCGTTGGGCGTGAACCGGTAA

Curator Acknowledgements
Curator Description Most Recent Edit