Mycobacterium tuberculosis whib7 mutations confer resistance to kanamycin

Accession ARO:3004967
DefinitionMutations in whib7 that can contribute to or confer resistance to kanamycin
AMR Gene Familykanamycin resistant whib7
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ kanamycin resistant whib7 [AMR Gene Family]
Resistomes

Prevalence of Mycobacterium tuberculosis whib7 mutations confer resistance to kanamycin among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Bit-score Cut-off (blastP): 125

Legend:

  • discovered in clinical, agricultural, or environmental isolates

  • discovered via laboratory selection experiments

  • ReSeqTB https://platform.reseqtb.org

Published Variants:

PMID in progress (TB): A-116G

ReSeqTB:

Minimal ConfidenceA-116G

>gb|CCP46011.1|+|Mycobacterium tuberculosis whib7 mutations confer resistance to kanamycin [Mycobacterium tuberculosis H37Rv] Partial
MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRRQCLAAALQRA
EPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA



>gb|AL123456.3|+|3568401-3568679|Mycobacterium tuberculosis whib7 mutations confer resistance to kanamycin [Mycobacterium tuberculosis H37Rv] Partial
CTATGCAACAGCATCCTTGCGCGGACGTCCGCGCGGACGCTTGTGACTCACGATCGAGCCTTGGTCGAATATCTCACCACCCCAAACGCC
CCAGGGTTCAGCCCGCTGAAGCGCCGCGGCCAAGCACTGCCGCCTGATCGGGCAGCTCACACACAGTGTCTTGGCTACCTCGAGACCGGC
CGGGGTATCGGCGAACCACAGATCGGGATCACCGACGTGGCACGGCAAAACCGGCAATCTTTGTCTGGGGGTCTGTCTGGGGACTGTCAG
TACCGACAC