tet(A)

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000165
Synonym(s)tetA
CARD Short Nametet(A)
DefinitionTetA is a tetracycline efflux pump found in many species of Gram-negative bacteria.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (71), Salmonella (26), Salmonella enterica (8), Clostridium perfringens (7), Klebsiella pneumoniae (5), Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 (5), Acinetobacter baumannii (5), Staphylococcus aureus (4), Acinetobacter (3), Bacillus (3)
GAZChina (3), Iuta (2), Baltic Sea (2)
FOODONwater food product (19), swine (7), fish (6), Bos taurus (6), chicken (3), chipped beef (2), cow milk (liquid) (2), dairy cow (2), food product for animal (2), meat (skinless) (2)
ENVOfarm (6), large river delta biome (5), landlocked sea (4), wastewater treatment plant (2), waste treatment plant (2)
UBERONmembrane organ (18), feces (6), animal hemisphere (3), proliferative region (2), manus (2)
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ tetR regulates
Resistomes with Perfect MatchesAcinetobacter johnsoniiwgs, Aeromonas caviaeg, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensisp, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Escherichia fergusoniiwgs, Klebsiella michiganensisp, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep, Morganella morganiiwgs, Proteus mirabilisg+wgs, Salmonella entericap+wgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Stenotrophomonas maltophiliawgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Acinetobacter indicuswgs, Acinetobacter johnsoniiwgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+p+wgs, Alcaligenes faecalisg+wgs, Avibacterium paragallinarumg, Burkholderia cenocepaciawgs, Burkholderia glumaeg, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+p+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaep, Cronobacter dublinensiswgs, Cronobacter sakazakiip, Edwardsiella tardap+wgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Escherichia marmotaep+wgs, Klebsiella aerogenesg+p+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensisg+wgs, Leclercia adecarboxylatap+wgs, Morganella morganiig+p+wgs, Pasteurella multocidawgs, Plesiomonas shigelloidesp+wgs, Proteus mirabilisg+p+wgs, Providencia alcalifaciensg, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensp+wgs, Pseudomonas monteiliiwgs, Pseudomonas putidag+p+wgs, Salmonella entericag+p+wgs, Serratia liquefacienswgs, Serratia marcescensg+p+wgs, Shigella boydiip+wgs, Shigella dysenteriaep+wgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Stenotrophomonas maltophiliag+wgs, Vibrio alginolyticuswgs, Vibrio choleraeg+p+wgs, Vibrio fluvialisg+wgs, Vibrio parahaemolyticuswgs, Vibrio vulnificuswgs, Yersinia enterocoliticap+wgs, Yersinia pseudotuberculosiswgs
Publications

Aldema ML, et al. 1996. Mol Microbiol 19(1): 187-195. Purification of the Tn10-specified tetracycline efflux antiporter TetA in a native state as a polyhistidine fusion protein. (PMID 8821947)

Roberts MC. 2005. FEMS Microbiol Lett 245(2): 195-203. Update on acquired tetracycline resistance genes. (PMID 15837373)

Resistomes

Prevalence of tet(A) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii3.01%0%1.82%0%0%
Acinetobacter indicus0%0%1.3%0%0%
Acinetobacter johnsonii0%0%1.82%0%0%
Aeromonas caviae18.18%1.3%12.37%0%0%
Aeromonas hydrophila7.69%3.9%4.03%0%0%
Aeromonas veronii9.09%1.54%8.99%0%0%
Alcaligenes faecalis10%0%2.94%0%0%
Avibacterium paragallinarum6.25%0%0%0%0%
Burkholderia cenocepacia0%0%5.04%0%0%
Burkholderia glumae1%0%0%0%0%
Citrobacter amalonaticus0%0%12.73%0%0%
Citrobacter freundii1.64%3.08%24.76%0%0%
Citrobacter koseri6.25%0%2.7%0%0%
Citrobacter portucalensis3.7%4.41%16.22%0%0%
Citrobacter werkmanii0%20%58.97%0%0%
Citrobacter youngae0%9.09%0%0%0%
Cronobacter dublinensis0%0%2.56%0%0%
Cronobacter sakazakii0%2.56%0%0%0%
Edwardsiella tarda0%15.79%20%0%0%
Enterobacter asburiae0%0%11.86%0%0%
Enterobacter chengduensis0%0%12%0%0%
Enterobacter cloacae1.79%5.03%23.64%0%0%
Enterobacter hormaechei1.44%2.51%16.57%0%0%
Enterobacter kobei0%0%13.54%0%0%
Enterobacter roggenkampii0%1.93%18.35%0%0%
Escherichia albertii4.29%2.82%5.81%0%0%
Escherichia coli3.55%5.18%32.27%0%27.08%
Escherichia fergusonii8.2%8.19%42.39%0%0%
Escherichia marmotae0%3.12%2.08%0%0%
Klebsiella aerogenes4%2.17%3.67%0%0%
Klebsiella michiganensis0%2.86%13.3%0%0%
Klebsiella oxytoca2.56%2.74%7.56%0%0%
Klebsiella pneumoniae1.95%6.39%26.58%0%0%
Klebsiella quasipneumoniae0%4.24%27.89%0%0%
Laribacter hongkongensis66.67%0%22.92%0%0%
Leclercia adecarboxylata0%4.76%4.65%0%0%
Morganella morganii1.92%2.5%9.2%0%0%
Pasteurella multocida0%0%0.75%0%0%
Plesiomonas shigelloides0%16.67%20.69%0%0%
Proteus mirabilis9.17%1.25%5.28%0%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia rettgeri0%0%1.91%0%0%
Providencia stuartii0%2.27%2.27%0%0%
Pseudomonas aeruginosa2.45%0.88%1.84%0%0%
Pseudomonas fluorescens0%11.11%0.43%0%0%
Pseudomonas monteilii0%0%4.76%0%0%
Pseudomonas putida1.41%12%0.53%0%0%
Salmonella enterica3.97%14.55%16.76%0%0%
Serratia liquefaciens0%0%3.17%0%0%
Serratia marcescens0.76%0.65%5.24%0%0%
Shigella boydii0%8.7%33.33%0%0%
Shigella dysenteriae0%4.55%13.33%0%0%
Shigella flexneri7%11.65%6.37%0%0%
Shigella sonnei0%8.74%38.86%0%0%
Stenotrophomonas maltophilia1.12%0%0.3%0%0%
Vibrio alginolyticus0%0%3.17%0%0%
Vibrio cholerae0.9%5.26%4.66%0%0%
Vibrio fluvialis2.63%0%5.33%0%0%
Vibrio parahaemolyticus0%0%0.41%0%0%
Vibrio vulnificus0%0%0.41%0%0%
Yersinia enterocolitica0%2.22%5.45%0%0%
Yersinia pseudotuberculosis0%0%1.47%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700


>gb|AAN06707.1|+|tet(A) [Shigella sonnei]
MSTNLSVIKNPRVQSDQRRLVRRPDVKPNRPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHYGILLALYALMQFACAPVLGA
LSDRFGRRPVLLVSLAGAAVDYAIMATAPFLWVLYIGRIVAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMG
GFSPHAPFFAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIMQLVGQVPAALWVIFGEDRFHWDA
TTIGISLAAFGILHSLAQAMITGPVAARLGERRALMLGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQ
LQGSLAALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWRNSSNSRCT


>gb|AF534183.1|+|2971-4245|tet(A) [Shigella sonnei]
ATGTCCACCAACTTATCAGTGATAAAGAATCCGCGCGTTCAATCGGACCAGCGGAGGCTGGTCCGGAGGCCAGACGTGAAACCCAACAGA
CCCCTGATCGTAATTCTGAGCACTGTCGCGCTCGACGCTGTCGGCATCGGCCTGATTATGCCGGTGCTGCCGGGCCTCCTGCGCGATCTG
GTTCACTCGAACGACGTCACCGCCCACTATGGCATTCTGCTGGCGCTGTATGCGTTGATGCAATTTGCCTGCGCACCTGTGCTGGGCGCG
CTGTCGGATCGTTTCGGGCGGCGGCCGGTCTTGCTCGTCTCGCTGGCCGGCGCTGCTGTCGACTACGCCATCATGGCGACGGCGCCTTTC
CTTTGGGTTCTCTATATCGGGCGGATCGTGGCCGGCATCACCGGGGCGACTGGGGCGGTAGCCGGCGCTTATATTGCCGATATCACTGAT
GGCGATGAGCGCGCGCGGCACTTCGGCTTCATGAGCGCCTGTTTCGGGTTCGGGATGGTCGCGGGACCTGTGCTCGGTGGGCTGATGGGC
GGTTTCTCCCCCCACGCTCCGTTCTTCGCCGCGGCAGCCTTGAACGGCCTCAATTTCCTGACGGGCTGTTTCCTTTTGCCGGAGTCGCAC
AAAGGCGAACGCCGGCCGTTACGCCGGGAGGCTCTCAACCCGCTCGCTTCGTTCCGGTGGGCCCGGGGCATGACCGTCGTCGCCGCCCTG
ATGGCGGTCTTCTTCATCATGCAACTTGTCGGACAGGTGCCGGCCGCGCTTTGGGTCATTTTCGGCGAGGATCGCTTTCACTGGGACGCG
ACCACGATCGGCATTTCGCTTGCCGCATTTGGCATTCTGCATTCACTCGCCCAGGCAATGATCACCGGCCCTGTAGCCGCCCGGCTCGGC
GAAAGGCGGGCACTCATGCTCGGAATGATTGCCGACGGCACAGGCTACATCCTGCTTGCCTTCGCGACACGGGGATGGATGGCGTTCCCG
ATCATGGTCCTGCTTGCTTCGGGTGGCATCGGAATGCCGGCGCTGCAAGCAATGTTGTCCAGGCAGGTGGATGAGGAACGTCAGGGGCAG
CTGCAAGGCTCACTGGCGGCGCTCACCAGCCTGACCTCGATCGTCGGACCCCTCCTCTTCACGGCGATCTATGCGGCTTCTATAACAACG
TGGAACGGGTGGGCATGGATTGCAGGCGCTGCCCTCTACTTGCTCTGCCTGCCGGCGCTGCGTCGCGGGCTTTGGAGAAATTCTTCAAAT
TCCCGTTGCACATAG

Curator Acknowledgements
Curator Description Most Recent Edit