tet(A)

Accession ARO:3000165
Synonym(s)tetA
DefinitionTetA is a tetracycline efflux pump found in many species of Gram-negative bacteria.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, fosfomycin, lincosamide antibiotic, nitroimidazole antibiotic, antibacterial free fatty acids, phenicol antibiotic, diaminopyrimidine antibiotic, fluoroquinolone antibiotic, cephalosporin, acridine dye, glycylcycline, penam, bicyclomycin, macrolide antibiotic, nucleoside antibiotic, rifamycin antibiotic, rhodamine, isoniazid, benzalkonium chloride, oxazolidinone antibiotic, peptide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesEscherichia coliwgs, Salmonella entericap+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Classification30 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic tigecycline [Antibiotic]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ tetR regulates
Publications

Aldema ML, et al. 1996. Mol Microbiol 19(1): 187-195. Purification of the Tn10-specified tetracycline efflux antiporter TetA in a native state as a polyhistidine fusion protein. (PMID 8821947)

Roberts MC. 2005. FEMS Microbiol Lett 245(2): 195-203. Update on acquired tetracycline resistance genes. (PMID 15837373)

Resistomes

Prevalence of tet(A) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii4.46%0%2.16%
Acinetobacter nosocomialis0%0%2%
Burkholderia cenocepacia0%0%8.36%
Citrobacter amalonaticus0%0%22.22%
Citrobacter freundii0%3.49%12.4%
Citrobacter koseri16.67%0%4.17%
Enterobacter asburiae0%0%1.56%
Enterobacter cloacae3.33%0%9.71%
Enterobacter hormaechei0%2.7%14.42%
Enterobacter kobei0%0%9.38%
Escherichia coli0.97%2.86%19.3%
Klebsiella oxytoca0%0%13.08%
Klebsiella pneumoniae0%0%0%
Morganella morganii0%0%7.14%
Proteus mirabilis0%3.7%9.48%
Providencia rettgeri0%0%0%
Providencia stuartii0%0%15.38%
Pseudomonas fluorescens0%14.29%0.81%
Pseudomonas putida0%10%1.25%
Salmonella enterica0.78%8.1%7.42%
Serratia marcescens0%0%2.3%
Shigella dysenteriae0%3.57%11.43%
Shigella flexneri0%4.26%6.23%
Shigella sonnei0%11.76%40.39%
Staphylococcus aureus0%0%0.01%
Staphylococcus pseudintermedius0%0%0.51%
Vibrio cholerae2.35%20%4.95%
Vibrio parahaemolyticus0%0%0.25%
Yersinia enterocolitica0%0%1.95%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|AAN06707.1|+|tet(A) [Shigella sonnei]
MSTNLSVIKNPRVQSDQRRLVRRPDVKPNRPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHYGILLALYALMQFACAPVLGA
LSDRFGRRPVLLVSLAGAAVDYAIMATAPFLWVLYIGRIVAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMG
GFSPHAPFFAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIMQLVGQVPAALWVIFGEDRFHWDA
TTIGISLAAFGILHSLAQAMITGPVAARLGERRALMLGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQ
LQGSLAALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWRNSSNSRCT


>gb|AF534183.1|+|2971-4245|tet(A) [Shigella sonnei]
ATGTCCACCAACTTATCAGTGATAAAGAATCCGCGCGTTCAATCGGACCAGCGGAGGCTGGTCCGGAGGCCAGACGTGAAACCCAACAGA
CCCCTGATCGTAATTCTGAGCACTGTCGCGCTCGACGCTGTCGGCATCGGCCTGATTATGCCGGTGCTGCCGGGCCTCCTGCGCGATCTG
GTTCACTCGAACGACGTCACCGCCCACTATGGCATTCTGCTGGCGCTGTATGCGTTGATGCAATTTGCCTGCGCACCTGTGCTGGGCGCG
CTGTCGGATCGTTTCGGGCGGCGGCCGGTCTTGCTCGTCTCGCTGGCCGGCGCTGCTGTCGACTACGCCATCATGGCGACGGCGCCTTTC
CTTTGGGTTCTCTATATCGGGCGGATCGTGGCCGGCATCACCGGGGCGACTGGGGCGGTAGCCGGCGCTTATATTGCCGATATCACTGAT
GGCGATGAGCGCGCGCGGCACTTCGGCTTCATGAGCGCCTGTTTCGGGTTCGGGATGGTCGCGGGACCTGTGCTCGGTGGGCTGATGGGC
GGTTTCTCCCCCCACGCTCCGTTCTTCGCCGCGGCAGCCTTGAACGGCCTCAATTTCCTGACGGGCTGTTTCCTTTTGCCGGAGTCGCAC
AAAGGCGAACGCCGGCCGTTACGCCGGGAGGCTCTCAACCCGCTCGCTTCGTTCCGGTGGGCCCGGGGCATGACCGTCGTCGCCGCCCTG
ATGGCGGTCTTCTTCATCATGCAACTTGTCGGACAGGTGCCGGCCGCGCTTTGGGTCATTTTCGGCGAGGATCGCTTTCACTGGGACGCG
ACCACGATCGGCATTTCGCTTGCCGCATTTGGCATTCTGCATTCACTCGCCCAGGCAATGATCACCGGCCCTGTAGCCGCCCGGCTCGGC
GAAAGGCGGGCACTCATGCTCGGAATGATTGCCGACGGCACAGGCTACATCCTGCTTGCCTTCGCGACACGGGGATGGATGGCGTTCCCG
ATCATGGTCCTGCTTGCTTCGGGTGGCATCGGAATGCCGGCGCTGCAAGCAATGTTGTCCAGGCAGGTGGATGAGGAACGTCAGGGGCAG
CTGCAAGGCTCACTGGCGGCGCTCACCAGCCTGACCTCGATCGTCGGACCCCTCCTCTTCACGGCGATCTATGCGGCTTCTATAACAACG
TGGAACGGGTGGGCATGGATTGCAGGCGCTGCCCTCTACTTGCTCTGCCTGCCGGCGCTGCGTCGCGGGCTTTGGAGAAATTCTTCAAAT
TCCCGTTGCACATAG