tet(A)

Accession ARO:3000165
Synonym(s)tetA
CARD Short Nametet(A)
DefinitionTetA is a tetracycline efflux pump found in many species of Gram-negative bacteria.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesAeromonas caviaeg, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Escherichia fergusoniiwgs, Klebsiella pneumoniaep+wgs, Morganella morganiiwgs, Proteus mirabilisg+wgs, Salmonella entericap+wgs, Shigella flexneriwgs, Shigella sonneiwgs, Stenotrophomonas maltophiliawgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter indicuswgs, Aeromonas caviaeg+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+p+wgs, Alcaligenes faecalisg, Bacillus subtiliswgs, Burkholderia cenocepaciawgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniip+wgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Enterococcus faeciumwgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Escherichia marmotaep+wgs, Haemophilus parainfluenzaewgs, Klebsiella aerogenesg+p+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensisg, Leclercia adecarboxylatap+wgs, Morganella morganiig+p+wgs, Pasteurella multocidawgs, Proteus mirabilisg+p+wgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas fluorescensp+wgs, Pseudomonas putidag+p+wgs, Pseudomonas stutzeriwgs, Pseudomonas syringaewgs, Raoultella planticolap, Salmonella entericag+p+wgs, Serratia marcescensg+p+wgs, Shigella boydiip+wgs, Shigella dysenteriaep+wgs, Shigella flexneriwgs, Shigella sonneiwgs, Staphylococcus aureuswgs, Staphylococcus epidermidiswgs, Staphylococcus pseudintermediuswgs, Stenotrophomonas maltophiliag+wgs, Vibrio choleraeg+p+wgs, Vibrio parahaemolyticuswgs, Yersinia enterocoliticap+wgs
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ tetR regulates
Publications

Aldema ML, et al. 1996. Mol Microbiol 19(1): 187-195. Purification of the Tn10-specified tetracycline efflux antiporter TetA in a native state as a polyhistidine fusion protein. (PMID 8821947)

Roberts MC. 2005. FEMS Microbiol Lett 245(2): 195-203. Update on acquired tetracycline resistance genes. (PMID 15837373)

Resistomes

Prevalence of tet(A) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii2.81%0.13%1.68%0%
Acinetobacter indicus0%0%1.39%0%
Aeromonas caviae10.71%0%6.31%0%
Aeromonas hydrophila7.5%5.56%1.06%0%
Aeromonas veronii7.41%2.86%8.73%0%
Alcaligenes faecalis7.14%0%0%0%
Bacillus subtilis0%0%0.34%0%
Burkholderia cenocepacia0%0%6.3%0%
Citrobacter amalonaticus0%0%8.33%0%
Citrobacter freundii0%2.6%14.18%0%
Citrobacter koseri7.69%0%1.11%0%
Citrobacter portucalensis5.56%0%22%0%
Citrobacter werkmanii0%20%23.81%0%
Enterobacter asburiae0%0%3.47%0%
Enterobacter chengduensis0%0%9.09%0%
Enterobacter cloacae0%3.68%18.64%0%
Enterobacter hormaechei1.79%4.92%11.98%0%
Enterobacter kobei0%0%10.66%0%
Enterobacter roggenkampii0%0.66%6.67%0%
Enterococcus faecium0%0%0.04%0%
Escherichia albertii10%13.16%4.6%0%
Escherichia coli3.23%4.48%22.41%0%
Escherichia fergusonii7.55%7.63%18.46%0%
Escherichia marmotae0%5%2.38%0%
Haemophilus parainfluenzae0%0%2.56%0%
Klebsiella aerogenes5%1.45%2.83%0%
Klebsiella michiganensis0%2.4%3.57%0%
Klebsiella oxytoca0%1.9%6.91%0%
Klebsiella pneumoniae2.06%5.19%20.76%0%
Klebsiella quasipneumoniae0%3.27%29.03%0%
Laribacter hongkongensis66.67%0%0%0%
Leclercia adecarboxylata0%3.85%14.29%0%
Morganella morganii2.04%2.7%6.25%0%
Pasteurella multocida0%0%0.53%0%
Proteus mirabilis6.25%1.61%5.17%0%
Providencia rettgeri0%0%2.59%0%
Providencia stuartii0%0%4.65%0%
Pseudomonas aeruginosa3.24%1.03%1.07%0%
Pseudomonas fluorescens0%14.29%0.44%0%
Pseudomonas putida2.04%15%0.76%0%
Pseudomonas stutzeri0%0%1.02%0%
Pseudomonas syringae0%0%0.24%0%
Raoultella planticola0%2.27%0%0%
Salmonella enterica2.28%13.02%13.68%0%
Serratia marcescens0.92%0.71%2.42%0%
Shigella boydii0%4.76%35.48%0%
Shigella dysenteriae0%5.56%10.71%0%
Shigella flexneri0%0%6.54%0%
Shigella sonnei0%0%39.23%0%
Staphylococcus aureus0%0%0.02%0%
Staphylococcus epidermidis0%0%0.1%0%
Staphylococcus pseudintermedius0%0%0.27%0%
Stenotrophomonas maltophilia1.61%0%0.2%0%
Vibrio cholerae1%6.25%3.92%0%
Vibrio parahaemolyticus0%0%0.39%0%
Yersinia enterocolitica0%3.03%1.66%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|AAN06707.1|+|tet(A) [Shigella sonnei]
MSTNLSVIKNPRVQSDQRRLVRRPDVKPNRPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHYGILLALYALMQFACAPVLGA
LSDRFGRRPVLLVSLAGAAVDYAIMATAPFLWVLYIGRIVAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMG
GFSPHAPFFAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIMQLVGQVPAALWVIFGEDRFHWDA
TTIGISLAAFGILHSLAQAMITGPVAARLGERRALMLGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQ
LQGSLAALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWRNSSNSRCT


>gb|AF534183.1|+|2971-4245|tet(A) [Shigella sonnei]
ATGTCCACCAACTTATCAGTGATAAAGAATCCGCGCGTTCAATCGGACCAGCGGAGGCTGGTCCGGAGGCCAGACGTGAAACCCAACAGA
CCCCTGATCGTAATTCTGAGCACTGTCGCGCTCGACGCTGTCGGCATCGGCCTGATTATGCCGGTGCTGCCGGGCCTCCTGCGCGATCTG
GTTCACTCGAACGACGTCACCGCCCACTATGGCATTCTGCTGGCGCTGTATGCGTTGATGCAATTTGCCTGCGCACCTGTGCTGGGCGCG
CTGTCGGATCGTTTCGGGCGGCGGCCGGTCTTGCTCGTCTCGCTGGCCGGCGCTGCTGTCGACTACGCCATCATGGCGACGGCGCCTTTC
CTTTGGGTTCTCTATATCGGGCGGATCGTGGCCGGCATCACCGGGGCGACTGGGGCGGTAGCCGGCGCTTATATTGCCGATATCACTGAT
GGCGATGAGCGCGCGCGGCACTTCGGCTTCATGAGCGCCTGTTTCGGGTTCGGGATGGTCGCGGGACCTGTGCTCGGTGGGCTGATGGGC
GGTTTCTCCCCCCACGCTCCGTTCTTCGCCGCGGCAGCCTTGAACGGCCTCAATTTCCTGACGGGCTGTTTCCTTTTGCCGGAGTCGCAC
AAAGGCGAACGCCGGCCGTTACGCCGGGAGGCTCTCAACCCGCTCGCTTCGTTCCGGTGGGCCCGGGGCATGACCGTCGTCGCCGCCCTG
ATGGCGGTCTTCTTCATCATGCAACTTGTCGGACAGGTGCCGGCCGCGCTTTGGGTCATTTTCGGCGAGGATCGCTTTCACTGGGACGCG
ACCACGATCGGCATTTCGCTTGCCGCATTTGGCATTCTGCATTCACTCGCCCAGGCAATGATCACCGGCCCTGTAGCCGCCCGGCTCGGC
GAAAGGCGGGCACTCATGCTCGGAATGATTGCCGACGGCACAGGCTACATCCTGCTTGCCTTCGCGACACGGGGATGGATGGCGTTCCCG
ATCATGGTCCTGCTTGCTTCGGGTGGCATCGGAATGCCGGCGCTGCAAGCAATGTTGTCCAGGCAGGTGGATGAGGAACGTCAGGGGCAG
CTGCAAGGCTCACTGGCGGCGCTCACCAGCCTGACCTCGATCGTCGGACCCCTCCTCTTCACGGCGATCTATGCGGCTTCTATAACAACG
TGGAACGGGTGGGCATGGATTGCAGGCGCTGCCCTCTACTTGCTCTGCCTGCCGGCGCTGCGTCGCGGGCTTTGGAGAAATTCTTCAAAT
TCCCGTTGCACATAG