tetR

Accession ARO:3003479
CARD Short NametetR
DefinitionTetR is the repressor of the tetracycline resistance element; its N-terminal region forms a helix-turn-helix structure and binds DNA. Binding of tetracycline to TetR reduces the repressor affinity for the tetracycline resistance gene (tetA) promoter operator sites. Mutations arise within tetR results in lower affinity for tetracyclin.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter nosocomialiswgs, Acinetobacter radioresistenswgs, Actinobacillus indolicusg, Actinobacillus pleuropneumoniaeg+gi, Actinobacillus porcitonsillarumg+gi, Avibacterium paragallinarumg+wgs+gi, Citrobacter amalonaticuswgs, Citrobacter freundiig+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Cronobacter sakazakiiwgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniig+p+wgs+gi, Glaesserella parasuisg+wgs, Haemophilus influenzaewgs+gi, Haemophilus parainfluenzaeg+wgs, Kingella kingaegi, Klebsiella aerogeneswgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs+gi, Mycobacterium tuberculosiswgs, Neisseria meningitidisg+wgs, Pasteurella multocidag+wgs+gi, Proteus columbaeg, Proteus mirabilisg+p+wgs, Proteus pennerig+wgs, Proteus vulgarisp+wgs, Providencia alcalifaciensg+wgs, Providencia rettgerig+wgs, Providencia stuartiig+wgs, Salmonella entericag+p+wgs+gi, Shigella boydiig+wgs, Shigella dysenteriaeg+p+wgs+gi, Shigella flexnerig+p+wgs+gi, Shigella sonneip+wgs, Staphylococcus aureuswgs, Vibrio alginolyticuswgs, Vibrio choleraep+wgs, Vibrio harveyip+wgs, Vibrio owensiig+gi, Vibrio parahaemolyticusg+p+wgs+gi, Vibrio vulnificuswgs
Classification12 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Smith LD, et al. 1988. J Mol Biol 203(4): 949-959. Mutations in the Tn10 tet repressor that interfere with induction. Location of the tetracycline-binding domain. (PMID 3062183)

Resistomes

Prevalence of tetR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein overexpression model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii40.53%1.04%54.74%27.67%0%
Acinetobacter nosocomialis0%0%1.15%0%0%
Acinetobacter radioresistens0%0%3.51%0%0%
Actinobacillus indolicus100%0%0%0%0%
Actinobacillus pleuropneumoniae5.56%0%0%100%0%
Actinobacillus porcitonsillarum100%0%0%100%0%
Avibacterium paragallinarum50%0%64.71%100%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0.82%0%5.42%0%0%
Citrobacter koseri0%0%1.8%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Citrobacter werkmanii0%0%7.69%0%0%
Cronobacter sakazakii0%0%0.22%0%0%
Enterobacter asburiae0%0.83%2.37%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter cloacae0%0.56%3.51%0%0%
Enterobacter hormaechei1.44%3.54%7.81%0%0%
Enterobacter kobei0%0.69%1.75%0%0%
Enterobacter roggenkampii0%0%1.8%0%0%
Escherichia albertii7.14%0%7.74%0%0%
Escherichia coli4.26%1.74%15.89%2.81%20.74%
Escherichia fergusonii6.56%3.91%10.87%100%0%
Glaesserella parasuis38.46%0%29.74%0%0%
Haemophilus influenzae0%0%0.8%25%0%
Haemophilus parainfluenzae6.25%0%4.88%0%0%
Kingella kingae0%0%0%100%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis9.68%2.29%1.6%0%0%
Klebsiella oxytoca0%0%3.78%0%0%
Klebsiella pneumoniae0.24%0.24%2.19%0.95%0%
Klebsiella quasipneumoniae0%0%0.79%0%0%
Leclercia adecarboxylata0%0%4.65%0%0%
Morganella morganii46.15%0%40.49%23.08%0%
Mycobacterium tuberculosis0%0%0.06%0%0%
Neisseria meningitidis1.53%0%7.04%0%0%
Pasteurella multocida6.43%0%6.37%50%0%
Proteus columbae100%0%0%0%0%
Proteus mirabilis0.92%2.5%1.82%0%0%
Proteus penneri50%0%12.5%0%0%
Proteus vulgaris0%22.22%16.67%0%0%
Providencia alcalifaciens18.18%0%3.45%0%0%
Providencia rettgeri2.94%0%23.57%0%0%
Providencia stuartii75%0%88.64%0%0%
Salmonella enterica7.13%3.12%11.73%12.25%0%
Shigella boydii6.67%0%18.89%0%0%
Shigella dysenteriae21.43%4.55%26.67%25%0%
Shigella flexneri47%0.8%81.37%23.81%0%
Shigella sonnei0%0.97%14.02%0%0%
Staphylococcus aureus0%0%0.01%0%0%
Vibrio alginolyticus0%0%1.19%0%0%
Vibrio cholerae0%10.53%0.06%0%0%
Vibrio harveyi0%14.29%4%0%0%
Vibrio owensii8.33%0%0%50%0%
Vibrio parahaemolyticus2.27%1.86%2.06%100%0%
Vibrio vulnificus0%0%1.22%0%0%
Show Perfect Only


Detection Models

Model Type: protein overexpression model

Model Definition: Protein Overexpression Models (POM) are similar to Protein Variant Models (PVM) in that they include a protein reference sequence, a curated BLASTP bitscore cut-off, and mapped resistance variants. Whereas PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, reporting only those with curated mutations conferring AMR, POMs are restricted to regulatory proteins and report both wild-type sequences and/or sequences with mutations leading to overexpression of efflux complexes. The former lead to efflux of antibiotics at basal levels, while the latter can confer clinical resistance. POMs include a protein reference sequence (often from wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Perfect RGI match is 100% identical to the wild-type reference protein sequence along its entire length, a Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value may or may not contain at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off may or may not contain at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 400

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
H64Ysingle resistance variantPMID:3062183
N82Hsingle resistance variantPMID:3062183
T103Isingle resistance variantPMID:3062183

>gb|CAD09823.1|+|tetR [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MMSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM
LDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTRPTEKQYETLENQLAF
LCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTTDSMPPLLRQAIELFDH
QGAEPAFLFGLELIICGLEKQLKCESGS



>gb|AL513383.1|+|179219-179845|tetR [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
ATGATGTCTAGATTAGATAAAAGTAAAGTGATTAACAGCGCATTAGAGCTGCTTAATGAGGTCGGAATCGAAGGTTTAACAACCCGTAAA
CTCGCCCAGAAGCTAGGTGTAGAGCAGCCTACATTGTATTGGCATGTAAAAAATAAGCGGGCTTTGCTCGACGCCTTAGCCATTGAGATG
TTAGATAGGCACCATACTCACTTTTGCCCTTTAGAAGGGGAAAGCTGGCAAGATTTTTTACGTAATAACGCTAAAAGTTTTAGATGTGCT
TTACTAAGTCATCGCGATGGAGCAAAAGTACATTTAGGTACACGGCCTACAGAAAAACAGTATGAAACTCTCGAAAATCAATTAGCCTTT
TTATGCCAACAAGGTTTTTCACTAGAGAATGCATTATATGCACTCAGCGCTGTGGGGCATTTTACTTTAGGTTGCGTATTGGAAGATCAA
GAGCATCAAGTCGCTAAAGAAGAAAGGGAAACACCTACTACTGATAGTATGCCGCCATTATTACGACAAGCTATCGAATTATTTGATCAC
CAAGGTGCAGAGCCAGCCTTCTTATTCGGCCTTGAATTGATCATATGCGGATTAGAAAAACAACTTAAATGTGAAAGTGGGTCTTAA

Curator Acknowledgements
Curator Description Most Recent Edit