tet(C)

Accession ARO:3000167
Synonym(s)tetC
DefinitionTet(C) is a tetracycline efflux pump found in many species of Gram-negative bacteria. It is typically found in plasmid DNA.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesAchromobacter xylosoxidansg, Burkholderia cepaciag+wgs, Citrobacter freundiip, Citrobacter youngaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Micrococcus luteuswgs, Mycobacterium tuberculosiswgs, Pseudomonas aeruginosag+wgs, Pseudomonas fluorescenswgs, Salmonella entericap+wgs, Serratia liquefaciensp, Staphylococcus epidermidiswgs, Stenotrophomonas maltophiliawgs, Vibrio choleraep+wgs
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Resistomes

Prevalence of tet(C) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Achromobacter xylosoxidans21.43%0%2.67%
Acinetobacter baumannii0%0%0.05%
Brucella abortus0%0%1.2%
Brucella suis0%0%3.03%
Burkholderia cepacia3.12%0%11.9%
Burkholderia pseudomallei0%0%0.07%
Chlamydia trachomatis4.1%0%2.56%
Citrobacter freundii0%0.94%0.64%
Citrobacter youngae0%0%25%
Clostridium botulinum0%0%0.57%
Enterobacter cloacae2.33%0%0.98%
Enterobacter hormaechei0%0%1.1%
Enterobacter kobei0%0%1.45%
Enterococcus faecalis0%0%0.33%
Enterococcus faecium0%0%0.12%
Escherichia coli0.17%0.08%1.38%
Francisella tularensis0%0%0.18%
Helicobacter pylori0%0%0.07%
Klebsiella aerogenes0%0%0.47%
Klebsiella oxytoca0%0%0%
Klebsiella pneumoniae0.2%0%0.62%
Micrococcus luteus0%0%1.82%
Mycobacterium tuberculosis0%0%0.06%
Neisseria gonorrhoeae0%0%0.5%
Proteus mirabilis11.9%0%3.35%
Providencia rettgeri0%0%0%
Providencia stuartii0%0%4.17%
Pseudomonas aeruginosa3.07%0%0.6%
Pseudomonas fluorescens0%0%0.56%
Pseudomonas stutzeri0%0%1.39%
Salmonella enterica0%0.18%0.67%
Serratia liquefaciens0%20%0%
Shigella sonnei0%0%0.47%
Staphylococcus aureus0%0%0.06%
Staphylococcus epidermidis0%0%0.4%
Staphylococcus lugdunensis0%0%9.09%
Stenotrophomonas maltophilia0%0%0.26%
Streptococcus agalactiae0%0%0.08%
Streptococcus pyogenes0%0%0.06%
Vibrio cholerae0%16.67%0.24%
Vibrio parahaemolyticus0%0%8.62%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AAK97755.1|-|tet(C) [Aeromonas salmonicida]
MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHYGVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIM
ATTPVLWILYAGRIVAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPFLAAAVLNGLNLLLGCFL
MQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIMQLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPA
TKRFGEKQAIIAGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSLAALTSLTSIIGPLIVTAIYA
ASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST


>gb|AY043299.1|-|3985-5175|tet(C) [Aeromonas salmonicida]
ATGAAATCTAACAATGCGCTCATCGTCATCCTCGGCACCGTCACCCTGGATGCTGTAGGCATAGGCTTGGTTATGCCGGTACTGCCGGGC
CTCTTGCGGGATATCGTCCATTCCGACAGCATCGCCAGTCACTATGGCGTGCTGCTAGCGCTATATGCGTTGATGCAATTTCTATGCGCA
CCCGTTCTCGGAGCACTGTCCGACCGCTTTGGCCGCCGCCCAGTCCTGCTCGCTTCGCTACTTGGAGCCACTATCGACTACGCGATCATG
GCGACCACACCCGTCCTGTGGATCCTCTACGCCGGACGCATCGTGGCCGGCATCACCGGCGCCACAGGTGCGGTTGCTGGCGCCTATATC
GCCGACATCACCGATGGGGAAGATCGGGCTCGCCACTTCGGGCTCATGAGCGCTTGTTTCGGCGTGGGTATGGTGGCAGGCCCCGTGGCC
GGGGGACTGTTGGGCGCCATCTCCTTGCATGCACCATTCCTTGCGGCGGCGGTGCTCAACGGCCTCAACCTACTACTGGGCTGCTTCCTA
ATGCAGGAGTCGCATAAGGGAGAGCGTCGACCGATGCCCTTGAGAGCCTTCAACCCAGTCAGCTCCTTCCGGTGGGCGCGGGGCATGACT
ATCGTCGCCGCACTTATGACTGTCTTCTTTATCATGCAACTCGTAGGACAGGTGCCGGCAGCGCTCTGGGTCATTTTCGGCGAGGACCGC
TTTCGCTGGAGCGCGACGATGATCGGCCTGTCGCTTGCGGTATTCGGAATCTTGCACGCCCTCGCTCAAGCCTTCGTCACTGGTCCCGCC
ACCAAACGTTTCGGCGAGAAGCAGGCCATTATCGCCGGCATGGCGGCCGACGCGCTGGGCTACGTCTTGCTGGCGTTCGCGACGCGAGGC
TGGATGGCCTTCCCCATTATGATTCTTCTCGCTTCCGGCGGCATCGGGATGCCCGCGTTGCAGGCCATGCTGTCCAGGCAGGTAGATGAC
GACCATCAGGGACAGCTTCAAGGATCGCTCGCGGCTCTTACCAGCCTAACTTCGATCATTGGACCGCTGATCGTCACGGCGATTTATGCC
GCCTCGGCGAGCACATGGAACGGGTTGGCATGGATTGTAGGCGCCGCCCTATACCTTGTCTGCCTCCCCGCGTTGCGTCGCGGTGCATGG
AGCCGGGCCACCTCGACCTGA