tet(C)

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000167
Synonym(s)tetC
CARD Short Nametet(C)
DefinitionTet(C) is a tetracycline efflux pump found in many species of Gram-negative bacteria. It is typically found in plasmid DNA.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (9), Salmonella (7)
GAZ
FOODONwater food product (7), dairy cow (3), swine (3), fish (2), Bos taurus (2)
ENVOlarge river delta biome (5), farm (5), landlocked sea (4), waste treatment plant (2)
UBERONfeces (5)
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Resistomes with Perfect MatchesAchromobacter xylosoxidansg+wgs+gi, Acinetobacter baumanniig, Aeromonas caviaeg+wgs, Aeromonas veroniip, Bacillus subtilisg, Bifidobacterium bifidumwgs, Burkholderia cepaciag+wgs, Citrobacter freundiiwgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Deinococcus radioduransg, Enterobacter asburiaewgs, Enterobacter cancerogenuswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia coliwgs, Faucicola osloensiswgs, Fusobacterium periodonticumwgs, Helicobacter cinaediwgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Micrococcus luteuswgs, Phocaeicola doreiwgs, Providencia rettgerig, Pseudomonas aeruginosag+p+wgs, Pseudomonas fluorescenswgs, Pseudomonas monteiliiwgs, Pseudomonas putidap, Salmonella entericawgs, Serratia liquefaciensp, Shewanella putrefaciensp, Staphylococcus epidermidiswgs, Stenotrophomonas maltophiliawgs, Streptococcus mutansp, Vibrio choleraep+wgs
Resistomes with Sequence VariantsAchromobacter insolitusg+wgs, Achromobacter xylosoxidansg+wgs+gi, Acinetobacter baumanniig+wgs+gi, Actinobacillus pleuropneumoniaeg, Aeromonas caviaeg+wgs+gi, Aeromonas hydrophilag+wgs+gi, Aeromonas veroniip+gi, Alcaligenes faecalisgi, Bacillus subtilisg, Bacteroides fragiliswgs, Bifidobacterium bifidumwgs, Bifidobacterium brevewgs, Burkholderia cepaciag+wgs, Burkholderia pseudomalleiwgs, Chlamydia suisg+wgs+gi, Chlamydia trachomatisg+wgs+gi, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Comamonas testosteronig, Cronobacter dublinensiswgs, Deinococcus radioduransg, Enterobacter asburiaewgs, Enterobacter cancerogenuswgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheip+wgs+gi, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Enterococcus faecaliswgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip, Faucicola osloensiswgs, Fusobacterium periodonticumwgs, Helicobacter cinaediwgs, Klebsiella aerogeneswgs+gi, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Laribacter hongkongensiswgs+gi, Leclercia adecarboxylatawgs, Micrococcus luteuswgs, Pasteurella multocidawgs, Phocaeicola doreiwgs, Proteus mirabilisg+wgs+gi, Proteus penneriwgs, Providencia rettgerig, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas fluorescenswgs, Pseudomonas monteiliiwgs, Pseudomonas putidap, Pseudomonas synxanthag, Salmonella entericag+p+wgs+gi, Serratia liquefaciensp, Serratia marcescenswgs, Shewanella putrefaciensp, Shigella sonneiwgs, Staphylococcus aureuswgs, Staphylococcus epidermidiswgs, Stenotrophomonas maltophiliag+wgs, Streptococcus mutansp, Stutzerimonas stutzeriwgs, Vibrio alginolyticuswgs, Vibrio choleraep+wgs, Vibrio parahaemolyticuswgs
Publications

Peden KW, et al. 1985. Gene 22(2-3):277-80 Revised sequence of the tetracycline-resistance gene of pBR322. (PMID 6307828)

Resistomes

Prevalence of tet(C) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Achromobacter insolitus60%0%71.43%0%0%
Achromobacter xylosoxidans13.04%0%2.29%28.57%0%
Acinetobacter baumannii0.18%0%0.07%2.52%0%
Actinobacillus pleuropneumoniae2.78%0%0%0%0%
Aeromonas caviae2.27%0%2.15%33.33%0%
Aeromonas hydrophila1.54%0%1.61%100%0%
Aeromonas veronii0%1.54%0%25%0%
Alcaligenes faecalis0%0%0%33.33%0%
Bacillus subtilis0.72%0%0%0%0%
Bacteroides fragilis0%0%0.27%0%0%
Bifidobacterium bifidum0%0%0.5%0%0%
Bifidobacterium breve0%0%0.6%0%0%
Burkholderia cepacia1.82%0%6.73%0%0%
Burkholderia pseudomallei0%0%0.06%0%0%
Chlamydia suis71.88%0%47.83%100%0%
Chlamydia trachomatis3.73%0%3.23%100%0%
Citrobacter freundii0%0%0.77%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%12.5%0%0%
Comamonas testosteroni20%0%0%0%0%
Cronobacter dublinensis0%0%2.56%0%0%
Deinococcus radiodurans20%0%0%0%0%
Enterobacter asburiae0%0%1.19%0%0%
Enterobacter cancerogenus0%0%14.29%0%0%
Enterobacter cloacae1.79%0%1.6%0%0%
Enterobacter hormaechei0%0.06%0.82%3.33%0%
Enterobacter kobei0%0%1.31%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Enterococcus faecalis0%0%0.04%0%0%
Escherichia albertii0%0%1.94%0%0%
Escherichia coli0.17%0.05%0.92%3.19%1.02%
Escherichia fergusonii0%0.36%0%0%0%
Faucicola osloensis0%0%7.14%0%0%
Fusobacterium periodonticum0%0%14.29%0%0%
Helicobacter cinaedi0%0%1.96%0%0%
Klebsiella aerogenes0%0%0.28%25%0%
Klebsiella oxytoca0%0%0.42%0%0%
Klebsiella pneumoniae0.06%0.03%0.28%1.9%0%
Klebsiella quasipneumoniae0%0%0.79%0%0%
Laribacter hongkongensis0%0%2.08%50%0%
Leclercia adecarboxylata0%0%2.33%0%0%
Micrococcus luteus0%0%1.11%0%0%
Pasteurella multocida0%0%1.5%0%0%
Phocaeicola dorei0%0%1.04%0%0%
Proteus mirabilis17.43%0%9.74%25.93%0%
Proteus penneri0%0%12.5%0%0%
Providencia rettgeri5.88%0%0%0%0%
Providencia stuartii0%0%2.27%0%0%
Pseudomonas aeruginosa1.69%1.17%0.54%9.72%0%
Pseudomonas fluorescens0%0%0.43%0%0%
Pseudomonas monteilii0%0%2.38%0%0%
Pseudomonas putida0%4%0%0%0%
Pseudomonas synxantha18.18%0%0%0%0%
Salmonella enterica0.06%0.16%0.69%5.3%0%
Serratia liquefaciens0%16.67%0%0%0%
Serratia marcescens0%0%0.13%0%0%
Shewanella putrefaciens0%20%0%0%0%
Shigella sonnei0%0%0.66%0%0%
Staphylococcus aureus0%0%0.01%0%0%
Staphylococcus epidermidis0%0%0.08%0%0%
Stenotrophomonas maltophilia1.12%0%0.45%0%0%
Streptococcus mutans0%33.33%0%0%0%
Stutzerimonas stutzeri0%0%0.76%0%0%
Vibrio alginolyticus0%0%0.4%0%0%
Vibrio cholerae0%5.26%0.13%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAK97755.1|-|tet(C) [Aeromonas salmonicida]
MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHYGVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIM
ATTPVLWILYAGRIVAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPFLAAAVLNGLNLLLGCFL
MQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIMQLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPA
TKRFGEKQAIIAGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSLAALTSLTSIIGPLIVTAIYA
ASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST


>gb|AY043299.1|-|3985-5175|tet(C) [Aeromonas salmonicida]
ATGAAATCTAACAATGCGCTCATCGTCATCCTCGGCACCGTCACCCTGGATGCTGTAGGCATAGGCTTGGTTATGCCGGTACTGCCGGGC
CTCTTGCGGGATATCGTCCATTCCGACAGCATCGCCAGTCACTATGGCGTGCTGCTAGCGCTATATGCGTTGATGCAATTTCTATGCGCA
CCCGTTCTCGGAGCACTGTCCGACCGCTTTGGCCGCCGCCCAGTCCTGCTCGCTTCGCTACTTGGAGCCACTATCGACTACGCGATCATG
GCGACCACACCCGTCCTGTGGATCCTCTACGCCGGACGCATCGTGGCCGGCATCACCGGCGCCACAGGTGCGGTTGCTGGCGCCTATATC
GCCGACATCACCGATGGGGAAGATCGGGCTCGCCACTTCGGGCTCATGAGCGCTTGTTTCGGCGTGGGTATGGTGGCAGGCCCCGTGGCC
GGGGGACTGTTGGGCGCCATCTCCTTGCATGCACCATTCCTTGCGGCGGCGGTGCTCAACGGCCTCAACCTACTACTGGGCTGCTTCCTA
ATGCAGGAGTCGCATAAGGGAGAGCGTCGACCGATGCCCTTGAGAGCCTTCAACCCAGTCAGCTCCTTCCGGTGGGCGCGGGGCATGACT
ATCGTCGCCGCACTTATGACTGTCTTCTTTATCATGCAACTCGTAGGACAGGTGCCGGCAGCGCTCTGGGTCATTTTCGGCGAGGACCGC
TTTCGCTGGAGCGCGACGATGATCGGCCTGTCGCTTGCGGTATTCGGAATCTTGCACGCCCTCGCTCAAGCCTTCGTCACTGGTCCCGCC
ACCAAACGTTTCGGCGAGAAGCAGGCCATTATCGCCGGCATGGCGGCCGACGCGCTGGGCTACGTCTTGCTGGCGTTCGCGACGCGAGGC
TGGATGGCCTTCCCCATTATGATTCTTCTCGCTTCCGGCGGCATCGGGATGCCCGCGTTGCAGGCCATGCTGTCCAGGCAGGTAGATGAC
GACCATCAGGGACAGCTTCAAGGATCGCTCGCGGCTCTTACCAGCCTAACTTCGATCATTGGACCGCTGATCGTCACGGCGATTTATGCC
GCCTCGGCGAGCACATGGAACGGGTTGGCATGGATTGTAGGCGCCGCCCTATACCTTGTCTGCCTCCCCGCGTTGCGTCGCGGTGCATGG
AGCCGGGCCACCTCGACCTGA

Curator Acknowledgements
Curator Description Most Recent Edit