Accession ARO:3000533
Synonym(s)pvdR
DefinitionMacA is a membrane fusion protein that forms an antibiotic efflux complex with MacB and TolC. macA corresponds to 1 locus in Pseudomonas aeruginosa PAO1 and 1 locus in Pseudomonas aeruginosa LESB58.
AMR Gene FamilyATP-binding cassette (ABC) antibiotic efflux pump
Drug Classrifamycin antibiotic, macrolide antibiotic, tetracycline antibiotic, peptide antibiotic, acridine dye, pleuromutilin antibiotic, fluoroquinolone antibiotic, nitroimidazole antibiotic, penam, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesNeisseria gonorrhoeaeg+wgs
Classification20 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Yum S, et al. 2009. J Mol Biol 387(5): 1286-1297. Crystal structure of the periplasmic component of a tripartite macrolide-specific efflux pump. (PMID 19254725)

Xu Y, et al. 2010. Biochem Biophys Res Commun 394(4): 962-965. The tip region of the MacA alpha-hairpin is important for the binding to TolC to the Escherichia coli MacAB-TolC pump. (PMID 20307498)

Resistomes

Prevalence of macA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Neisseria gonorrhoeae100%0%99.83%
Neisseria meningitidis100%0%98.02%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 760


>gb|AAV85981.1|+|macA [Neisseria gonorrhoeae]
MAKMMKWSAVAAVAAAAVWGGWHYLKPEPQAAYITETVRRGGISRTVSATGEISPSNLVSVGAQASGQIKKLYVKLGQQVKKGDLIAEIN
STTQTNTLNMEKSKLETYQAKLVSAQIALGSAEKKYKRQTALWKDDATSKEDLESAQDALAAAKANVAELKALIRQSKISINTAESDLGY
TRITATMDGTVVAIPVEEGQTVNAAQSTPTIVQLANLDMMLNKMQIAEGDITKVKAGQDISFTILSEPDTPIKAKLDSVDPGLTTMSSGG
YNSSTDTASNAVYYYARSFVPNPDGKLATGMTTQNTVEIDGVKNVLLIPSLTVKNRGGKAFVRVLGADGKAAEREIRTGMRDSMNTEVKS
GLKEGDKVVISEITAAEQQESGERALGGPPRR


>gb|AY768531|+|1-1179|macA [Neisseria gonorrhoeae]
ATGGCGAAAATGATGAAATGGTCGGCTGTTGCGGCAGTCGCGGCGGCAGCGGTTTGGGGCGGATGGCATTATCTGAAGCCCGAACCGCAG
GCTGCTTATATTACGGAAACGGTCAGGCGCGGCGGCATCAGCCGGACGGTTTCCGCGACGGGCGAGATTTCGCCGTCGAATCTGGTATCG
GTCGGCGCGCAGGCTTCGGGGCAGATTAAAAAGCTTTATGTCAAACTCGGGCAACAGGTCAAAAAGGGAGATTTGATTGCGGAAATCAAT
TCGACCACGCAGACCAACACGCTCAATATGGAAAAATCTAAATTGGAAACGTATCAGGCGAAGCTGGTGTCGGCACAGATTGCATTGGGC
AGCGCGGAGAAGAAATATAAGCGTCAGACGGCGTTGTGGAAGGATGATGCGACCTCTAAAGAAGATTTGGAAAGCGCGCAGGATGCGCTT
GCCGCCGCCAAAGCCAATGTTGCCGAGTTGAAGGCTTTAATCAGACAGAGCAAAATTTCCATCAATACCGCCGAGTCGGATTTGGGCTAC
ACGCGCATTACCGCGACGATGGACGGCACGGTGGTGGCGATTCCCGTGGAAGAGGGGCAAACCGTGAACGCGGCGCAGTCTACGCCGACG
ATTGTCCAATTGGCGAATCTGGATATGATGTTGAACAAAATGCAGATTGCCGAGGGCGATATTACCAAGGTGAAGGCGGGGCAGGATATT
TCGTTTACGATTTTGTCCGAACCGGATACGCCGATTAAGGCGAAGCTCGACAGCGTCGACCCCGGGCTGACCACGATGTCGTCGGGCGGC
TACAACAGCAGTACGGATACGGCTTCCAATGCGGTCTATTATTATGCCCGTTCGTTTGTGCCGAATCCGGACGGCAAACTCGCCACGGGG
ATGACGACGCAGAATACGGTTGAAATCGACGGTGTGAAAAATGTGTTGCTTATTCCGTCGCTGACCGTGAAAAATCGCGGCGGCAAGGCG
TTCGTACGCGTGTTGGGTGCGGACGGCAAGGCGGCGGAACGCGAAATCCGGACCGGTATGAGAGACAGTATGAATACCGAAGTGAAAAGC
GGGTTGAAAGAGGGGGACAAAGTGGTCATCTCCGAAATAACCGCCGCCGAGCAGCAGGAAAGCGGCGAACGCGCCCTAGGCGGCCCGCCG
CGCCGATAA