Accession ARO:3000535
Synonym(s)pvdT
DefinitionMacB is an ATP-binding cassette (ABC) transporter that exports macrolides with 14- or 15- membered lactones. It forms an antibiotic efflux complex with MacA and TolC. macB corresponds to 1 locus in Pseudomonas aeruginosa PAO1 and 1 locus in Pseudomonas aeruginosa LESB58.
AMR Gene FamilyATP-binding cassette (ABC) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic, rifamycin antibiotic, acridine dye, tetracycline antibiotic, macrolide antibiotic, pleuromutilin antibiotic, cephalosporin, peptide antibiotic, penam, nitroimidazole antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesNeisseria gonorrhoeaeg+wgs
Classification20 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Xu Y, et al. 2009. Biochemistry 48(23): 5218-5225. Crystal structure of the periplasmic region of MacB, a noncanonic ABC transporter. (PMID 19432486)

Kobayashi N, et al. 2003. FEBS Lett 546(2-3): 241-246. Membrane topology of ABC-type macrolide antibiotic exporter MacB in Escherichia coli. (PMID 12832048)

Nishino K, et al. 2005. Mol Microbiol 59(1): 126-141. Virulence and drug resistance roles of multidrug efflux systems of Salmonella enterica serovar Typhimurium. (PMID 16359323)

Resistomes

Prevalence of macB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Neisseria gonorrhoeae100%0%99.83%
Neisseria meningitidis100%0%97.96%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1280


>gb|AAV85982.1|+|macB [Neisseria gonorrhoeae]
MSLIECKNINRYFGSGENRVHILKDISLSIEKGDFVAIIGQSGSGKSTLMNILGCLDTAGSGSYRIDGIETAKMQPDELAALRRERFGFI
FQRYNLLSSLTARDNVALPAVYMGMGGKERSARADKLLQDLGLASKEGNKPGELSGGQQQRVSIARALMNGGEIIFADEPTGALDTASGK
NVMEIIRRLHEAGHTVIMVTHDPGIAANANRVIEIRDGEIISDTSKNPEIPASNVGRIQEKASWSFYYDQFVEAFRMSVQAVLAHKMRSL
LTMLGIIIGIASVVSVVALGNGSQKKILEDISSMGTNTISIFPGRGFGDRRSGKIKTLTIDDAKIIAKQSYVASATPMTSSGGTLTYRNT
DLTASLYGVGEQYFDVRGLKLETGRLFDENDVKEDAQVVVIDQNVKDKLFADSDPLGKTILFRKRPLTVIGVMKKDENAFGNSDVLMLWS
PYTTVMHQITGESHTNSITVKIKDNANTRVAEKGLAELLKARHGTEDFFMNNSDSIRQMVESTTGTMKLLISSIALISLVVGGIGVMNIM
LVSVTERTKEIGIRMAIGARRGNILQQFLIEAVLICIIGGLVGVGLSAAVSLVFNHFVTDFPMDISAASVIGAVACSTGIGIAFGFMPAN
KAAKLNPIDALAQD


>gb|AY768532|+|1-1935|macB [Neisseria gonorrhoeae]
ATGAGCTTGATCGAATGTAAAAACATCAACCGCTATTTCGGCAGCGGCGAGAACCGCGTCCATATTTTGAAAGACATCAGCCTGTCGATA
GAGAAGGGTGATTTTGTCGCCATCATCGGGCAGTCCGGTTCGGGCAAGTCCACGCTGATGAACATACTCGGTTGTTTGGATACCGCCGGT
TCCGGTTCGTACCGAATCGACGGCATCGAAACTGCCAAAATGCAGCCTGACGAACTGGCGGCATTGCGGCGCGAACGCTTCGGTTTCATC
TTCCAACGCTACAACCTCTTAAGCTCGCTGACCGCAAGGGACAACGTCGCGCTGCCAGCCGTGTATATGGGTATGGGAGGCAAAGAGCGT
TCCGCGCGGGCGGACAAACTCTTGCAGGATTTGGGTTTGGCAAGTAAAGAGGGCAACAAGCCCGGCGAACTCTCGGGCGGACAGCAGCAG
CGCGTCTCCATCGCCCGCGCCCTGATGAACGGCGGAGAAATCATCTTCGCCGACGAGCCGACCGGCGCACTCGATACCGCCAGCGGCAAA
AATGTGATGGAAATCATCCGCAGGCTGCACGAAGCCGGGCATACCGTCATTATGGTCACGCACGACCCCGGCATTGCCGCCAATGCCAAC
CGCGTCATCGAAATCCGGGACGGCGAAATCATTTCCGACACCTCGAAAAATCCCGAAATCCCCGCAAGCAATGTCGGGAGGATTCAGGAA
AAAGCCTCGTGGTCGTTTTATTACGACCAGTTTGTCGAAGCCTTCAGAATGTCGGTGCAAGCAGTATTGGCGCACAAAATGCGTTCGCTT
CTGACCATGCTCGGCATCATCATCGGTATCGCTTCGGTTGTCTCCGTCGTCGCGCTGGGCAACGGGTCGCAGAAAAAAATCCTCGAAGAC
ATCAGTTCGATGGGGACGAACACCATCAGCATCTTCCCCGGGCGCGGCTTCGGCGACAGGCGCAGCGGCAAAATCAAAACCCTGACCATA
GACGACGCAAAAATCATCGCCAAACAAAGCTATGTTGCTTCCGCCACGCCCATGACTTCGAGCGGCGGCACGCTGACCTACCGCAATACC
GACCTGACCGCTTCTTTGTACGGCGTGGGCGAACAATATTTCGACGTGCGCGGGCTGAAGCTGGAAACGGGGCGGCTGTTTGATGAGAAC
GATGTGAAAGAAGACGCGCAAGTCGTCGTCATCGACCAAAATGTCAAAGACAAACTCTTTGCGGACTCGGATCCGTTGGGTAAAACCATT
TTGTTCAGGAAACGCCCCTTGACCGTCATCGGCGTGATGAAAAAAGACGAAAACGCTTTCGGCAATTCCGACGTGCTGATGCTTTGGTCG
CCCTATACGACGGTGATGCACCAAATCACAGGCGAGAGCCACACCAACTCCATCACCGTCAAAATCAAAGACAATGCCAATACCCGGGTT
GCCGAAAAAGGGCTGGCCGAGCTGCTCAAAGCACGGCACGGCACGGAAGACTTCTTTATGAACAACAGCGACAGCATCAGGCAGATGGTC
GAAAGCACCACCGGTACGATGAAGCTGCTGATTTCCTCCATCGCCCTGATTTCATTGGTAGTCGGCGGCATCGGCGTGATGAACATTATG
CTGGTGTCCGTTACCGAGCGCACCAAAGAAATCGGCATACGGATGGCAATCGGCGCGCGGCGCGGCAATATTTTGCAGCAGTTTTTGATT
GAGGCGGTGTTAATCTGCATCATCGGAGGCTTGGTCGGCGTAGGTTTGTCCGCCGCCGTCAGCCTCGTGTTCAATCATTTTGTAACCGAT
TTCCCGATGGACATTTCGGCGGCATCCGTTATCGGGGCGGTCGCCTGTTCGACCGGAATCGGCATCGCGTTCGGCTTTATGCCTGCCAAT
AAGGCAGCCAAACTCAATCCGATAGACGCATTGGCGCAGGATTGA