tet(38)

Accession ARO:3000565
Synonym(s)tet38
CARD Short Nametet(38)
DefinitionTet38 is a tetracycline efflux pump found in the Gram-positive Staphylococcus aureus. It is regulated by mgrA, which also regulates NorB.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesStaphylococcus aureuswgs
Resistomes with Sequence VariantsEscherichia coliwgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidiswgs, Streptococcus pneumoniaewgs
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ mgrA regulates
Publications

Truong-Bolduc QC, et al. 2005. J Bacteriol 187(7): 2395-2405. MgrA is a multiple regulator of two new efflux pumps in Staphylococcus aureus. (PMID 15774883)

Resistomes

Prevalence of tet(38) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.02%0%
Staphylococcus aureus99.9%0.87%58.76%0%
Staphylococcus epidermidis0%0%0.09%0%
Streptococcus pneumoniae0%0%0.01%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 850


>gb|AAV80464.1|+|tet(38) [Staphylococcus aureus]
MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVTTVSWQATLAGLVIGIGAVVYASLSDAISIRTLFIYGVILIIIGSI
IGYIFQHQFPLLLVGRIIQTAGLAAAETLYVIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLHWTNMFLIALIVVFTLPF
LFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLYMIGALIAIIVFALYIKNAQRPLVNKSFFQNKRYASFLFIVFVMYAIQL
GYIFTFPFIMEQIYHLQLDTTSLLLVPGYIVAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAVGNHISIFVISMIFFAGSFAL
MYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAIAAALIDFKALNFPGNDALSSHFGIILIILGLMSIVGLVLFVILNRWTQSEK


>gb|AY825285.1|+|1-1353|tet(38) [Staphylococcus aureus]
ATGAATGTTGAATATTCTAAAATAAAGAAAGCAGTACCTATTTTATTATTCTTATTTGTATTCAGTTTGGTTATAGACAACTCATTTAAA
TTGATTTCTGTAGCCATTGCTGATGACTTAAACATATCTGTAACGACAGTAAGTTGGCAAGCGACATTAGCCGGTTTAGTAATTGGTATT
GGCGCTGTAGTATACGCTTCATTATCTGATGCCATTAGTATACGCACACTATTTATTTATGGCGTGATATTAATCATTATCGGATCAATT
ATTGGTTACATTTTCCAACATCAATTCCCATTACTTTTAGTTGGACGTATTATTCAAACTGCCGGTTTAGCTGCTGCAGAGACATTATAT
GTGATATATGTTGCAAAGTATCTTTCTAAAGAGGACCAGAAGACTTACCTTGGCTTAAGTACGAGCAGTTATTCCTTGTCATTAGTTATC
GGTACATTATCAGGTGGATTTATTTCTACGTATTTACACTGGACAAATATGTTTTTAATTGCATTAATCGTAGTATTTACGTTGCCATTC
CTATTTAAATTATTACCAAAAGAAAATAATACGAATAAAGCTCATTTAGATTTTGTTGGCTTAATTCTAGTGGCAACTATTGCTACAACA
GTCATGCTGTTTATTACGAACTTTAATTGGTTATATATGATTGGTGCCTTAATTGCGATTATCGTTTTTGCGCTATATATTAAAAATGCG
CAACGTCCATTAGTAAATAAATCATTTTTCCAAAATAAACGTTATGCTTCATTTTTATTTATAGTATTTGTAATGTATGCTATCCAATTG
GGTTATATTTTTACGTTCCCATTCATAATGGAGCAAATTTATCATCTGCAACTAGACACAACATCACTGTTATTAGTACCGGGTTATATA
GTAGCAGTCATTGTTGGTGCATTAAGTGGTAAAATCGGCGAATATCTGAATTCAAAACAAGCGATTATCACAGCAATTATTTTAATAGCA
CTGAGCTTGATTTTACCTGCATTTGCAGTAGGTAATCACATTTCAATCTTCGTCATTTCTATGATATTCTTTGCAGGTAGCTTTGCTTTA
ATGTATGCACCTTTACTTAACGAAGCCATTAAAACAATAGATCTTAATATGACAGGTGTGGCTATTGGTTTTTATAATTTAATTATTAAT
GTGGCGGTATCTGTAGGTATTGCGATTGCTGCGGCTCTAATCGATTTTAAAGCATTAAATTTCCCAGGCAATGATGCATTAAGTTCACAT
TTCGGTATTATTTTAATTATTTTAGGTTTAATGAGTATTGTCGGATTAGTTTTATTCGTCATCTTAAATCGTTGGACACAATCTGAAAAA
TAA