mgrA

Accession ARO:3000815
Synonym(s)norR
CARD Short NamemgrA
DefinitionMgrA, also known as NorR, is a regulator for norA, norB, and tet38. It is a positive regulator for norA expression, but is a direct repressor for norB and an indirect repressor of tet38.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, tetracycline antibiotic, penam, fluoroquinolone antibiotic, disinfecting agents and antiseptics, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs
Resistomes with Sequence VariantsEscherichia coliwgs, Klebsiella pneumoniaewgs, Listeria monocytogeneswgs, Shigella flexneriwgs, Staphylococcus aureusg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus lugdunensiswgs, Vibrio choleraewgs
Classification28 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ regulates norA
+ regulates norB
+ protein(s) and two-component regulatory system modulating antibiotic efflux [Efflux Regulator]
+ regulates tet(38)
+ regulates abcA
Publications

Truong-Bolduc QC, et al. 2003. J Bacteriol 185(10): 3127-3138. Characterization of NorR protein, a multifunctional regulator of norA expression in Staphylococcus aureus. (PMID 12730173)

Truong-Bolduc QC, et al. 2005. J Bacteriol 187(7): 2395-2405. MgrA is a multiple regulator of two new efflux pumps in Staphylococcus aureus. (PMID 15774883)

Resistomes

Prevalence of mgrA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.03%0%
Klebsiella pneumoniae0%0%0.01%0%
Listeria monocytogenes0%0%0.03%0%
Shigella flexneri0%0%0.16%0%
Staphylococcus aureus99.76%0%61.02%0%
Staphylococcus epidermidis11.24%0%13.03%0%
Staphylococcus haemolyticus0%0%0.6%0%
Staphylococcus lugdunensis0%0%9.09%0%
Vibrio cholerae0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 270


>gb|BAB41874.1|-|mgrA [Staphylococcus aureus subsp. aureus N315]
MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVD
QREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDETKEK


>gb|BA000018.3|-|735417-735860|mgrA [Staphylococcus aureus subsp. aureus N315]
ATGTCTGATCAACATAATTTAAAAGAACAGCTATGCTTTAGTTTGTACAATGCTCAAAGACAAGTTAATCGCTACTACTCTAACAAAGTT
TTTAAGAAGTACAATCTAACATACCCACAATTTCTTGTCTTAACAATTTTATGGGATGAATCTCCTGTAAACGTCAAGAAAGTCGTAACT
GAATTAGCACTCGATACTGGTACAGTATCACCATTATTAAAACGAATGGAACAAGTAGACTTAATTAAGCGTGAACGTTCCGAAGTCGAT
CAACGTGAAGTATTTATTCACTTGACTGACAAAAGTGAAACTATTAGACCAGAATTAAGTAATGCATCTGACAAAGTCGCTTCAGCTTCT
TCTTTATCTCAAGATGAAGTTAAAGAACTTAATCGCTTATTAGGTAAAGTCATTCATGCATTTGATGAAACAAAGGAAAAATAA