mgrA

Accession ARO:3000815
Synonym(s)norR
CARD Short NamemgrA
DefinitionMgrA, also known as NorR, is a regulator for norA, norB, and tet38. It is a positive regulator for norA expression, but is a direct repressor for norB and an indirect repressor of tet38.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump, ATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, penam, fluoroquinolone antibiotic, cephalosporin, disinfecting agents and antiseptics, tetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs
Resistomes with Sequence VariantsBurkholderia vietnamiensiswgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Listeria monocytogeneswgs, Shigella flexneriwgs, Staphylococcus aureusg+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus lugdunensiswgs, Vibrio choleraewgs
Classification28 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ protein(s) and two-component regulatory system modulating antibiotic efflux [Efflux Regulator]
+ regulates norA
+ regulates norB
+ regulates tet(38)
+ regulates abcA
Publications

Truong-Bolduc QC, et al. 2003. J Bacteriol 185(10): 3127-3138. Characterization of NorR protein, a multifunctional regulator of norA expression in Staphylococcus aureus. (PMID 12730173)

Truong-Bolduc QC, et al. 2005. J Bacteriol 187(7): 2395-2405. MgrA is a multiple regulator of two new efflux pumps in Staphylococcus aureus. (PMID 15774883)

Resistomes

Prevalence of mgrA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Burkholderia vietnamiensis0%0%0.86%0%
Escherichia coli0%0%0.03%0%
Klebsiella pneumoniae0%0%0.01%0%
Listeria monocytogenes0%0%0.03%0%
Shigella flexneri0%0%0.16%0%
Staphylococcus aureus100%0%58.69%0%
Staphylococcus capitis100%0%66.01%0%
Staphylococcus epidermidis10.91%0%13.15%0%
Staphylococcus haemolyticus0%0%0.44%0%
Staphylococcus lugdunensis0%0%1.85%0%
Vibrio cholerae0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 270


>gb|BAB41874.1|-|mgrA [Staphylococcus aureus subsp. aureus N315]
MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVD
QREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDETKEK


>gb|BA000018.3|-|735417-735860|mgrA [Staphylococcus aureus subsp. aureus N315]
ATGTCTGATCAACATAATTTAAAAGAACAGCTATGCTTTAGTTTGTACAATGCTCAAAGACAAGTTAATCGCTACTACTCTAACAAAGTT
TTTAAGAAGTACAATCTAACATACCCACAATTTCTTGTCTTAACAATTTTATGGGATGAATCTCCTGTAAACGTCAAGAAAGTCGTAACT
GAATTAGCACTCGATACTGGTACAGTATCACCATTATTAAAACGAATGGAACAAGTAGACTTAATTAAGCGTGAACGTTCCGAAGTCGAT
CAACGTGAAGTATTTATTCACTTGACTGACAAAAGTGAAACTATTAGACCAGAATTAAGTAATGCATCTGACAAAGTCGCTTCAGCTTCT
TCTTTATCTCAAGATGAAGTTAAAGAACTTAATCGCTTATTAGGTAAAGTCATTCATGCATTTGATGAAACAAAGGAAAAATAA