abcA

Accession ARO:3003942
DefinitionAbcA is a multidrug resistant ABC transporter that confers resistance to methicillin, daptomycin, cefotaxime, and moenomycin.
AMR Gene FamilyATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, cephalosporin, penam
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification13 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic methicillin [Antibiotic]
+ confers_resistance_to_antibiotic daptomycin [Antibiotic]
+ ATP-binding cassette (ABC) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic cefotaxime [Antibiotic]
+ confers_resistance_to_antibiotic moenomycin A1 [Antibiotic]
Sub-Term(s)
1 ontology terms | Show
+ mgrA regulates
Publications

McCallum N, et al. 2010. Int. J. Med. Microbiol. 300(2-3):118-29 Regulation of antibiotic resistance in Staphylococcus aureus. (PMID 19800843)

Yoshikai H, et al. 2016. J. Infect. Dis. 213(2):295-304 Multidrug-Resistance Transporter AbcA Secretes Staphylococcus aureus Cytolytic Toxins. (PMID 26160745)

Villet RA, et al. 2014. J. Bacteriol. 196(8):1532-9 Regulation of expression of abcA and its response to environmental conditions. (PMID 24509312)

Resistomes

Prevalence of abcA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 3000


>gb|XP_753111.1|+|abcA [Aspergillus fumigatus Af293]
MNESHEAGKNSSTNVEEREEEVLRLARQFTEQSSYSTAGQTPFAAEAGSALDPNGERFNARAWCKAMLQMHIGDKEAHPLRTLGVAFSNL
NVHGFGSDTDYQKSVGNVWLKTLSLARIAFGQKQRKVDILQNLEGLVEAGEMLVVLGPPGSGCSTFLKTIAGETYGFHVDKNSNINFQGI
AKQMAHEFRGEAIYTAEVDVHFPKLTVGDTLYFAARARTPRHIPGGVNATQYAGHMRDVIMAMFGISHTKNTIVGNDFIRGVSGGERKRV
SIAEACLSNAPLQCWDNSTRGLDSANAIEFCKTLRMQADINGTTACVSLYQAPQAAYDYFDKVLVLYEGREIYFGPTSMAKHYFLQMGFV
CPDRQTDADFLTSMTSHLERVVQPGYEDRVPRTPDEFAARWKASPQRAQLMQHIKSYNAKFALDGEYLDKFKQSRRAQQAKAQRVSSPYT
LSYVQQVKLCLWRGYQRLKADPSVTISSLFGNTIISLVIASIFYNLKADTSTFFQRGALLFFAVLMNALGCGLEMLTLYAQRGIIEKHSR
YALYHPSAEAFSSMIMDLPYKILNAITSNIVLYFMTNLRREPGAFFFFVFTSFILTLTMSMFFRSMASLSRSLVQVLPFSAVLLLGLSMY
TGFAIPTGYMLGWARWIAYINPISYGFESLMINEFHNRDFPCMDYVPSGPGYTDVGLNNRVCSTVRSVPGQAFVNGNAYIESAYSYTASH
KWRNIGVIFAYMFLLGAVYLVATDFITEKKPKGEILVFPRGHKALKKGKSDEDLEGGGGRSATVEKIGSDGLAMIERQTAIFQWKDVCFD
IKIGKENCRILDHVDGWVKPGILTALMGVSGAGKTTLLDVLATRTTMGIISGEMLVDGQPRDESFQRKTGYAQQQDLHLSTATVREALEF
SALLRQSAHVPRQEKIDYVTEVIKLLDMTEYADAVIGVPGEGLNVEQRKRLTIGVELAARPQLLLFLDEPTSGLDSQTSWAILDLLDKLK
KNGQAILCTIHQPSAMLFQRFDRLLFLQAGGRTVYFGEIGQNSQILIDYFVRNGAPPCPPDANPAEWMLDVIGAAPGSHTSINWFETWRR
SPEYARVQEHLAELKHERRHQTNLFRTTSGQKREDKDSYREFAAPFWAQLYQVQVRVFQQIWRSPTYIYSKTALCVLSALFVGFSLFHTP
NTIQGLQNQMFGIFMLLTLFGQLIQQIMPHFVAQRALYEVRDRPAKTYSWKAFLIANIVVELPWNSLMSVLMFLCWYYPIGLYRNAEPTD
AVHLRGTQMWLMIWTFLLFSSTFAHFMIAAFDAAENAGNLGNLLFLLCLLFCGVLATPDQLPRFWIFMYRVSPFTYLVSGMLSVGISNTN
VTCADNEYLRFDPVNGTCGEYMGSYMSNLGGYLADEMATANCSFCPIKETNVFLGRVSSSYSDIWRNFGLMWVFIVFNIFAACSLYWWVR
VPRDKKPVAKAE


>gb|XM_748018.1|+|1-4359|abcA [Aspergillus fumigatus Af293]
ATGAATGAAAGTCATGAAGCTGGAAAAAATTCCTCTACCAATGTGGAGGAGAGGGAAGAGGAGGTTCTTCGGCTAGCCAGACAGTTCACA
GAGCAGAGCAGCTATTCCACGGCGGGACAAACCCCCTTTGCTGCGGAGGCCGGATCGGCCCTGGACCCCAATGGTGAACGCTTCAACGCT
CGGGCATGGTGCAAGGCCATGCTGCAGATGCACATTGGGGACAAGGAGGCACACCCACTGCGAACCTTGGGGGTCGCCTTCAGCAATCTC
AATGTGCATGGTTTCGGTTCCGACACTGATTACCAGAAAAGCGTCGGCAATGTCTGGTTAAAGACGCTCAGCCTGGCAAGAATAGCATTT
GGTCAAAAGCAGCGCAAAGTCGACATTTTGCAGAACTTGGAAGGATTGGTGGAGGCTGGAGAGATGCTCGTCGTACTTGGACCCCCTGGA
TCTGGATGCTCCACTTTTTTGAAGACCATTGCTGGAGAGACTTACGGCTTTCATGTGGACAAAAACTCAAACATCAATTTCCAAGGCATC
GCAAAGCAGATGGCCCACGAGTTCAGGGGTGAAGCCATCTATACCGCAGAGGTTGATGTCCACTTCCCCAAGCTCACGGTTGGAGATACC
CTTTATTTCGCGGCTCGTGCCCGAACACCACGACACATTCCTGGGGGGGTGAATGCGACCCAGTATGCCGGCCACATGCGAGACGTGATC
ATGGCCATGTTTGGTATCAGCCATACGAAGAACACAATTGTCGGAAACGACTTCATCCGCGGTGTATCTGGTGGAGAGCGCAAGCGGGTT
AGCATTGCGGAAGCTTGTCTCAGCAATGCACCGCTGCAATGTTGGGACAATTCGACTCGTGGTCTTGATAGTGCGAATGCCATTGAGTTC
TGCAAAACCTTACGCATGCAGGCAGATATCAATGGCACCACAGCCTGTGTCTCTCTATATCAAGCTCCCCAGGCTGCGTACGACTATTTC
GATAAGGTCCTGGTCCTATACGAAGGTCGCGAGATCTACTTTGGTCCCACATCCATGGCGAAGCACTACTTCCTTCAGATGGGCTTCGTA
TGCCCTGACCGGCAAACCGATGCCGACTTTCTCACATCTATGACTAGCCATCTTGAGCGTGTTGTTCAGCCTGGTTATGAAGATCGCGTA
CCTCGAACACCTGATGAGTTCGCTGCACGATGGAAGGCCTCACCACAGCGAGCACAGCTGATGCAACACATCAAGAGTTATAATGCAAAG
TTCGCACTGGATGGGGAATACCTGGATAAGTTTAAGCAATCTCGGCGAGCCCAGCAAGCCAAGGCTCAGCGGGTATCATCACCCTACACT
CTTTCCTATGTCCAACAGGTGAAACTGTGCCTGTGGCGCGGGTATCAACGATTGAAGGCTGACCCCAGTGTCACAATCTCTTCATTATTC
GGAAATACTATCATATCCCTAGTTATCGCCAGTATCTTCTACAACCTCAAGGCTGACACCAGCACCTTTTTTCAGCGTGGTGCTCTTCTC
TTCTTTGCTGTTCTTATGAACGCTCTTGGCTGCGGCCTTGAAATGCTGACTCTATACGCGCAACGAGGGATCATCGAGAAGCACTCCCGA
TACGCTCTCTACCATCCATCTGCTGAAGCTTTTTCATCAATGATAATGGATTTGCCCTATAAGATTCTCAACGCCATTACGTCCAATATA
GTTCTGTACTTCATGACCAACTTGAGGAGAGAACCCGGGGCTTTCTTCTTCTTTGTCTTCACTTCGTTCATCCTGACTCTGACCATGTCC
ATGTTCTTCCGGTCTATGGCATCGCTATCCAGATCCCTTGTCCAAGTTCTGCCCTTCTCCGCCGTGCTACTTCTCGGTCTCAGCATGTAC
ACTGGGTTCGCTATCCCGACTGGATATATGCTGGGCTGGGCTCGCTGGATTGCGTACATCAATCCCATCAGCTATGGCTTTGAGTCACTG
ATGATCAATGAGTTCCACAACCGCGATTTCCCGTGCATGGACTATGTCCCATCGGGTCCTGGCTATACGGATGTCGGGCTCAACAACCGT
GTTTGCTCCACCGTCAGATCAGTGCCTGGACAAGCCTTTGTCAATGGCAATGCTTACATTGAGTCAGCATATAGCTATACCGCTTCTCAC
AAATGGAGAAACATCGGTGTCATATTCGCTTACATGTTCCTGCTTGGGGCGGTCTATCTCGTTGCTACTGACTTCATCACCGAGAAGAAG
CCGAAGGGCGAGATCCTGGTATTTCCTCGCGGACACAAGGCTCTGAAGAAAGGCAAGTCAGATGAGGATCTTGAAGGGGGTGGTGGCCGC
AGCGCCACAGTCGAGAAGATCGGCTCAGATGGCCTTGCCATGATTGAACGCCAAACCGCAATCTTCCAGTGGAAGGATGTCTGCTTCGAT
ATCAAGATTGGAAAGGAGAATTGCAGGATTCTTGACCATGTTGACGGATGGGTCAAACCGGGAATCTTGACGGCGCTTATGGGTGTTTCG
GGTGCTGGAAAGACCACGCTCTTGGATGTCCTTGCTACGCGCACCACGATGGGGATTATCAGTGGAGAAATGCTCGTCGATGGTCAACCG
CGTGATGAGTCCTTTCAACGTAAGACCGGCTATGCTCAGCAACAAGATCTGCATTTGAGTACTGCTACCGTGCGCGAGGCACTTGAGTTC
TCTGCTCTTCTACGTCAATCTGCTCACGTTCCTCGTCAAGAGAAGATTGACTACGTGACAGAAGTGATCAAGCTTCTTGACATGACGGAG
TATGCTGATGCCGTTATTGGGGTGCCTGGTGAAGGCCTGAACGTTGAGCAACGTAAACGTCTCACAATCGGGGTAGAGCTTGCAGCCAGA
CCCCAACTCCTCCTTTTCCTAGACGAACCGACCTCAGGACTTGATTCTCAGACATCCTGGGCTATTCTTGATCTCCTCGATAAACTGAAG
AAGAACGGCCAGGCTATTTTGTGTACCATCCATCAACCATCTGCCATGCTGTTTCAGCGCTTTGATCGTCTCCTCTTCCTTCAAGCTGGG
GGTCGTACTGTCTACTTTGGAGAAATCGGTCAGAACTCGCAAATACTGATTGACTACTTCGTCCGCAACGGTGCCCCTCCATGTCCTCCG
GATGCGAATCCTGCCGAATGGATGCTGGATGTGATCGGTGCCGCTCCCGGATCACACACCAGCATCAACTGGTTCGAGACCTGGCGTCGA
TCCCCCGAATATGCACGAGTCCAAGAGCACCTTGCTGAACTGAAACACGAACGTCGCCACCAAACAAACCTGTTCCGCACTACATCCGGC
CAAAAGCGCGAAGACAAAGACAGCTACCGCGAGTTCGCTGCTCCTTTCTGGGCCCAGCTCTACCAAGTCCAAGTACGAGTCTTCCAGCAA
ATCTGGCGGTCACCCACCTACATCTACTCCAAGACCGCTCTCTGCGTGTTATCCGCTCTCTTCGTCGGCTTCTCCCTTTTCCATACACCC
AACACCATCCAAGGCCTCCAGAATCAAATGTTCGGCATCTTCATGCTACTTACCCTGTTCGGCCAGCTTATCCAACAAATCATGCCGCAT
TTCGTCGCCCAGCGCGCGCTGTATGAAGTCCGCGACCGACCTGCAAAAACCTACTCTTGGAAAGCCTTCCTCATCGCCAACATCGTTGTT
GAACTCCCCTGGAACTCGCTCATGTCCGTCCTTATGTTCCTGTGCTGGTACTACCCGATTGGTCTTTACCGCAATGCCGAACCAACTGAT
GCGGTGCACTTGCGGGGCACGCAAATGTGGCTGATGATCTGGACCTTCCTTCTCTTCTCGTCCACCTTTGCCCATTTTATGATCGCAGCG
TTTGACGCCGCCGAGAACGCGGGAAACCTCGGAAACCTGCTTTTCCTGCTTTGTCTGCTTTTCTGCGGCGTGCTAGCGACACCGGATCAG
CTCCCACGGTTCTGGATCTTCATGTATCGCGTTTCGCCGTTTACATATCTGGTGAGCGGGATGTTGTCTGTGGGTATATCGAATACGAAT
GTCACCTGCGCGGACAATGAGTATCTGCGCTTTGACCCCGTCAATGGGACTTGCGGCGAGTACATGGGCTCATACATGTCGAATCTGGGC
GGGTACCTTGCAGACGAGATGGCGACTGCGAACTGCAGCTTCTGCCCGATCAAGGAGACGAATGTGTTCCTCGGTAGAGTTTCGTCGAGT
TACTCGGATATCTGGAGGAACTTTGGGCTCATGTGGGTATTTATTGTTTTCAATATCTTTGCAGCTTGTTCGCTGTACTGGTGGGTTCGT
GTTCCACGAGACAAGAAGCCAGTTGCAAAGGCCGAGTGA