norA

Accession ARO:3000391
DefinitionNorA is a multidrug efflux pump in Staphylococcus aureus that confers resistance to fluoroquinolones and other structurally unrelated antibiotics like acriflavine. It shares 30% similarity with NorA, and is a structural homolog of Bmr of Bacillus subtilis. It is regulated by arlRS and mgrA, the latter also known as NorR.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, cephalosporin, isoniazid, rhodamine, rifamycin antibiotic, oxazolidinone antibiotic, acridine dye, diaminopyrimidine antibiotic, bicyclomycin, lincosamide antibiotic, phenicol antibiotic, peptide antibiotic, nucleoside antibiotic, fluoroquinolone antibiotic, antibacterial free fatty acids, fosfomycin, macrolide antibiotic, penam, nitroimidazole antibiotic, glycylcycline, benzalkonium chloride
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesStaphylococcus epidermidisg+wgs
Classification30 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Sub-Term(s)
2 ontology terms | Show
+ arlRS regulates
+ mgrA regulates
Publications

Truong-Bolduc QC, et al. 2003. J Bacteriol 185(10): 3127-3138. Characterization of NorR protein, a multifunctional regulator of norA expression in Staphylococcus aureus. (PMID 12730173)

Neyfakh AA, et al. 1993. Antimicrob Agents Chemother 37(1): 128-129. Fluoroquinolone resistance protein NorA of Staphylococcus aureus is a multidrug efflux transporter. (PMID 8431010)

Truong-Bolduc QC, et al. 2005. J Bacteriol 187(7): 2395-2405. MgrA is a multiple regulator of two new efflux pumps in Staphylococcus aureus. (PMID 15774883)

Resistomes

Prevalence of norA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Staphylococcus epidermidis95.45%0%98.53%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|AAS68233.1|+|norA [Staphylococcus epidermidis]
MKKQLFILYFNIFLIFLGIGLVIPVLPVYLKDLGLKGSDLGMLVAAFALSQMIISPFGGTLADKLGKKLIICIGLVFFAVSEFMFAAGQS
FTILIISRVLGGFSAGMVMPGVTGMIADISPGADKAKNFGYMSAIINSGFILGPGFGGFLAEISHRLPFYVAGTLGVVAFIMSVLLIHNP
QKATTDGFHQYQPELFTKINWKVFITPVILTLVLAFGLSAFETLFSLYTADKVNYTPKDISIAIIGGGVFGALFQVFFFDKFMKYMSELN
FIAWSLLYSAIVLVMLVLANGYWTIMIISFVVFIGFDMIRPALTNYFSNIAGKRQGFAGGLNSTFTSMGNFIGPLVAGALFDVNLEFPLY
MAIAVSLSGIIIIFIEKGLKSRRKEAN


>gb|AY566250|+|392-1555|norA [Staphylococcus epidermidis]
ATGAAAAAACAATTATTCATTCTTTATTTTAATATATTTCTTATATTTTTAGGGATTGGATTAGTTATTCCTGTACTTCCTGTATATTTG
AAGGATTTAGGATTAAAAGGTAGTGACTTAGGAATGCTAGTTGCTGCTTTTGCATTATCACAAATGATTATTTCACCATTTGGTGGGACA
CTAGCTGATAAATTGGGTAAAAAATTAATTATATGTATCGGTTTAGTATTCTTTGCTGTCTCTGAATTTATGTTCGCAGCCGGTCAAAGT
TTTACCATTTTAATCATTTCACGTGTTTTAGGTGGCTTTAGTGCAGGCATGGTCATGCCTGGTGTAACAGGTATGATTGCAGATATTTCT
CCAGGAGCTGATAAAGCTAAAAACTTTGGTTACATGTCGGCAATTATTAATTCAGGTTTTATATTAGGACCTGGATTTGGAGGCTTTTTA
GCTGAAATTTCACATAGATTACCTTTCTATGTTGCTGGAACATTAGGTGTTGTTGCATTCATTATGTCAGTTTTATTAATTCATAATCCT
CAAAAAGCAACTACAGATGGATTCCACCAATATCAACCTGAATTATTCACTAAAATTAATTGGAAAGTATTTATTACTCCAGTCATATTA
ACACTTGTATTAGCATTTGGTTTATCTGCTTTTGAAACATTATTTTCTTTATATACAGCTGACAAAGTAAATTATACTCCTAAAGATATT
TCGATAGCTATTATCGGTGGAGGCGTGTTTGGCGCATTATTCCAAGTATTCTTCTTTGATAAATTTATGAAATATATGAGTGAACTTAAT
TTTATTGCATGGTCATTACTATATTCAGCCATTGTTCTCGTTATGTTAGTGCTTGCAAACGGTTATTGGACGATTATGATTATTAGCTTT
GTTGTTTTTATAGGTTTTGATATGATTAGACCAGCTTTAACCAATTACTTCTCGAATATAGCAGGCAAACGGCAAGGTTTTGCAGGTGGA
TTGAATTCAACTTTTACCAGTATGGGTAACTTTATAGGTCCTCTTGTAGCTGGTGCATTATTCGATGTTAATTTAGAGTTTCCTTTATAT
ATGGCTATTGCGGTTTCATTAAGTGGAATTATCATTATTTTTATTGAAAAAGGACTTAAGTCACGCCGTAAAGAAGCAAATTAA