tet(40)

Accession ARO:3000567
Synonym(s)tet40
DefinitionTet40 is a tetracycline efflux pump found in the Gram-positive Clostridium. It is similar to tetA(P).
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, rhodamine, benzalkonium chloride, glycylcycline, nitroimidazole antibiotic, fosfomycin, antibacterial free fatty acids, acridine dye, peptide antibiotic, fluoroquinolone antibiotic, isoniazid, rifamycin antibiotic, macrolide antibiotic, nucleoside antibiotic, bicyclomycin, lincosamide antibiotic, phenicol antibiotic, cephalosporin, oxazolidinone antibiotic, diaminopyrimidine antibiotic, penam
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification30 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
Publications

Kazimierczak KA, et al. 2008. Antimicrob Agents Chemother 52(11): 4001-4009. A new tetracycline efflux gene, tet(40), is located in tandem with tet(O/32/O) in a human gut firmicute bacterium and in metagenomic library clones. (PMID 18779355)

Resistomes

Prevalence of tet(40) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecium0%0%0.14%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 750


>gb|CAM12479.1|+|tet(40) [uncultured bacterium]
MFAKNSKAYSVYLLFRFVCSLAVSMSTVLSIVYHLEVVQLDAFQLVLVGTVQEASCFLFEMPTGVVADLYSRRRSVLIGMFLYGLGFLME
GALPWFAPVLLAQVVWGCGDTFITGALEAWIASEEEDKPIDKVFLRGSQMGQIGGVLGVVLGTLLGNINLQMPLILGGSLCLLLGLVMVR
IMPETNFSPAIEERQGLLKDFVCLFKLNLGFVKGAPVLLALLAITLCGGLASEGFDRLSTAHFLDDTVIPVIGPLNSVTWFGVISLIGNG
LGILASQLLIARMEKKGTVSRTSVVMSTSAGYILFLVLFAVGRSFWFMLLVFLLAGLMRTIKEPVLAAWMNDHVDEKMRATVFSTSGQLD
SFGQIIGGPIVGLVAQQVSIPWGLVCTAFLLLPALFLVPVAGKKRD


>gb|AM419751|+|14211-15431|tet(40) [uncultured bacterium]
ATGTTTGCTAAAAATTCAAAGGCATATTCTGTCTACCTGCTGTTCCGATTTGTCTGTTCCCTGGCGGTTTCTATGTCCACAGTGCTTTCC
ATCGTGTACCACCTGGAGGTGGTGCAGCTGGATGCTTTCCAGCTTGTCCTGGTAGGGACGGTTCAGGAGGCCTCCTGCTTTCTGTTCGAG
ATGCCCACCGGTGTGGTGGCGGATTTGTATAGCCGTCGGCGCTCGGTGCTGATTGGAATGTTCCTCTACGGCCTGGGCTTTCTGATGGAG
GGTGCGCTACCGTGGTTCGCGCCGGTTCTGCTGGCCCAGGTTGTCTGGGGTTGCGGTGATACCTTCATCACCGGCGCTCTGGAGGCGTGG
ATTGCCTCGGAGGAAGAGGACAAACCCATAGACAAGGTGTTCCTGCGGGGCAGTCAAATGGGGCAAATCGGCGGCGTTCTGGGCGTGGTG
CTGGGCACACTGCTGGGAAACATAAACCTGCAAATGCCTCTCATCTTGGGGGGCAGTTTGTGCTTGTTGTTGGGGCTGGTGATGGTTCGC
ATCATGCCAGAAACCAACTTCTCCCCTGCTATTGAGGAACGGCAGGGCTTGCTTAAAGACTTTGTCTGCCTGTTCAAGCTCAACCTGGGC
TTTGTGAAAGGCGCACCTGTGTTGCTGGCGCTCTTAGCAATCACACTATGCGGGGGACTTGCCAGTGAAGGCTTTGACCGGCTCTCCACC
GCTCATTTTCTGGATGACACGGTAATACCCGTTATCGGGCCGCTGAACAGCGTCACTTGGTTCGGTGTTATCAGTCTTATCGGCAACGGC
TTAGGTATTCTGGCTTCTCAGTTGCTCATCGCCCGCATGGAGAAAAAAGGGACTGTCAGCCGAACCAGTGTGGTCATGTCCACCAGCGCC
GGGTATATCCTGTTCCTGGTTCTCTTCGCGGTGGGGCGGAGCTTTTGGTTCATGTTGTTGGTGTTCCTGCTGGCGGGGCTTATGCGCACC
ATCAAGGAGCCTGTGCTGGCCGCCTGGATGAACGACCATGTGGATGAGAAAATGCGCGCCACAGTCTTTTCCACCAGCGGACAGCTGGAC
TCTTTCGGGCAGATCATCGGCGGGCCTATTGTGGGGCTGGTAGCCCAGCAGGTGTCCATACCCTGGGGGCTGGTCTGTACCGCTTTCCTG
CTGTTGCCCGCGCTGTTCTTAGTGCCGGTGGCGGGAAAGAAGCGGGATTGA