PC1 beta-lactamase (blaZ)

Download Sequences


Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000621
CARD Short NamePC1_blaZ
DefinitionThe blaZ beta-lactamase is found in Bacillus subtilis and Staphylococcus aureus.
AMR Gene FamilyBlaZ beta-lactamase
Drug Classpenicillin beta-lactam
Resistance Mechanismantibiotic inactivation
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ part_of bla operon
+ BlaZ beta-lactamase [AMR Gene Family]
Sub-Term(s)
2 ontology terms | Show
+ blaR1 regulates
+ blaI regulates
Resistomes with Perfect MatchesStaphylococcus aureusp+wgs
Resistomes with Sequence VariantsBacillus cereusg, Enterococcus faecaliswgs, Enterococcus faeciumwgs, Escherichia coliwgs, Listeria monocytogeneswgs, Providencia alcalifacienswgs, Pseudomonas aeruginosawgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus capitisg+p+wgs, Staphylococcus epidermidisg+p+wgs+gi, Staphylococcus equorump+wgs, Staphylococcus haemolyticusg+p+wgs+gi, Staphylococcus hominisg+p+wgs+gi, Staphylococcus lugdunensisg+p+wgs+gi, Staphylococcus massiliensiswgs, Staphylococcus pasteurig+p+wgs+gi, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticusg+wgs, Staphylococcus schleiferig, Staphylococcus simulansg+p+wgs+gi, Staphylococcus warnerip+wgs, Streptococcus pneumoniaewgs
Publications

McLaughlin JR, et al. 1981. J Biol Chem 256(21): 11283-11291. Unique features in the ribosome binding site sequence of the gram-positive Staphylococcus aureus beta-lactamase gene. (PMID 6793593)

Highlander SK, et al. 2008. BMC Microbiol 7: 99. Subtle genetic changes enhance virulence of methicillin resistant and sensitive Staphylococcus aureus. (PMID 17986343)

Resistomes

Prevalence of PC1 beta-lactamase (blaZ) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Bacillus cereus1.08%0%0%0%0%
Enterococcus faecalis0%0%0.62%0%0%
Enterococcus faecium0%0%0.03%0%0%
Escherichia coli0%0%0.01%0%0%
Listeria monocytogenes0%0%0.02%0%0%
Providencia alcalifaciens0%0%3.45%0%0%
Pseudomonas aeruginosa0%0%0.01%0%0%
Staphylococcus aureus29.67%16%70.32%27.22%0%
Staphylococcus capitis30%10.53%60.76%0%0%
Staphylococcus epidermidis81.94%7.78%77.24%45.71%0%
Staphylococcus equorum0%5.41%7.14%0%0%
Staphylococcus haemolyticus62.07%1.89%70.33%26.67%0%
Staphylococcus hominis62.5%2.08%62.93%100%0%
Staphylococcus lugdunensis47.22%3.57%29.23%100%0%
Staphylococcus massiliensis0%0%14.29%0%0%
Staphylococcus pasteuri37.5%5.88%26.92%100%0%
Staphylococcus pseudintermedius70%0%75.38%26.67%0%
Staphylococcus saprophyticus5.88%0%3.5%0%0%
Staphylococcus schleiferi9.09%0%0%0%0%
Staphylococcus simulans15%5.88%3.39%100%0%
Staphylococcus warneri0%15%49.18%0%0%
Streptococcus pneumoniae0%0%0.01%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ABX30738.1|-|PC1 beta-lactamase (blaZ) [Staphylococcus aureus subsp. aureus USA300_TCH959]
MKKLIFLIVIALVLSACNSNSSHAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINK
DDIVAYSPILEKYVGKDIALKELIEASMKYSDNTANNKIINEIGGIKKIKKRLKKLGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKT
LNKLIANGKLSKKNKNFLLDLMLNNKNGDTLIKDGIPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLI
SETAKSVMKEF


>gb|CP000732.1|-|9683-10528|PC1 beta-lactamase (blaZ) [Staphylococcus aureus subsp. aureus USA300_TCH959]
TTGAAAAAGTTAATATTTTTAATTGTAATTGCTTTAGTTTTAAGTGCATGTAATTCAAACAGTTCACATGCCAAAGAGTTAAATGATTTA
GAAAAAAAATATAATGCTCATATTGGTGTTTATGCTTTAGATACTAAAAGTGGTAAGGAAGTAAAATTTAATTCAGATAAGAGATTTGCC
TATGCTTCGACTTCAAAAGCGATAAATAGTGCTATTTTGTTAGAACAAGTACCTTATAATAAGTTAAATAAAAAAGTACATATTAACAAA
GATGATATAGTTGCTTATTCTCCTATTTTAGAAAAATATGTAGGAAAAGATATCGCTTTAAAAGAACTTATTGAGGCTTCAATGAAGTAC
AGTGATAATACAGCAAACAATAAAATTATAAACGAAATCGGTGGAATCAAAAAAATTAAAAAACGTTTAAAAAAATTGGGAGATAAAGTA
ACAAATCCAGTTAGATATGAAATAGAATTAAATTACTATTCACCAAAGAGCAAAAAAGATACTTCAACGCCTGCTGCTTTCGGCAAGACT
TTAAATAAACTTATCGCAAATGGAAAATTAAGCAAAAAAAATAAAAATTTCTTACTTGATTTAATGTTAAATAATAAAAACGGAGACACT
TTAATTAAAGATGGTATTCCAAAAGACTATAAAGTTGCTGATAAAAGTGGTCAAGCAATAACATATGCTTCTAGAAATGATGTTGCTTTT
GTTTATCCTAAGGGCCAATCTGAACCTATTGTTTTAGTCATTTTTACGAATAAAGACAATAAAAGTGATAAGCCAAATGATAAGTTGATA
AGTGAAACCGCCAAGAGTGTAATGAAGGAATTTTAA

Curator Acknowledgements
Curator Description Most Recent Edit