mdtA

Download Sequences

Accession	ARO:3000792
Synonym(s)	yegM
CARD Short Name	mdtA
Definition	MdtA is the membrane fusion protein of the multidrug efflux complex mdtABC.
AMR Gene Family	resistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Class	aminocoumarin antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Escherichia coli^g+p+wgs, Shigella boydii^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Escherichia albertii^g+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^g+p+wgs, Escherichia marmotae^g+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic efflux [Resistance Mechanism] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + aminocoumarin antibiotic [Drug Class] + novobiocin [Antibiotic] + resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
Parent Term(s)	2 ontology terms \| Show + subunit of efflux pump conferring antibiotic resistance + part_of MdtABC-TolC
Publications	Nagakubo S, et al. 2002. J Bacteriol 184(15): 4161-4167. The putative response regulator BaeR stimulates multidrug resistance of Escherichia coli via a novel multidrug exporter system, MdtABC. (PMID 12107133)

Resistomes

Prevalence of mdtA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia albertii	100%	0%	98.06%	0%	0%
Escherichia coli	10.98%	0.01%	8.65%	0%	5.27%
Escherichia coli	67.25%	0.04%	98.79%	0%	99.78%
Escherichia fergusonii	100%	0.36%	97.83%	0%	0%
Escherichia fergusonii	0%	0%	0%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Escherichia marmotae	100%	0%	97.92%	0%	0%
Shigella boydii	13.33%	0%	4.44%	0%	0%
Shigella boydii	93.33%	0%	95.56%	0%	0%
Shigella dysenteriae	0%	0%	0%	0%	0%
Shigella dysenteriae	28.57%	0%	66.67%	0%	0%
Shigella flexneri	10%	0%	0.31%	0%	0%
Shigella flexneri	37%	0%	4.5%	0%	0%
Shigella sonnei	0%	0%	0.73%	0%	0%
Shigella sonnei	100%	0%	99.05%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 725

Protein
DNA

>gb|AAC75135.2|+|mdtA [Escherichia coli str. K-12 substr. MG1655]
MKGSYKSRWVIVIVVVIAAIAAFWFWQGRNDSRSAAPGATKQAQQSPAGGRRGMRSGPLAPVQAATAVEQAVPRYLTGLGTITAANTVTV
RSRVDGQLIALHFQEGQQVKAGDLLAEIDPSQFKVALAQAQGQLAKDKATLANARRDLARYQQLAKTNLVSRQELDAQQALVSETEGTIK
ADEASVASAQLQLDWSRITAPVDGRVGLKQVDVGNQISSGDTTGIVVITQTHPIDLVFTLPESDIATVVQAQKAGKPLVVEAWDRTNSKK
LSEGTLLSLDNQIDATTGTIKVKARFNNQDDALFPNQFVNARMLVDTEQNAVVIPTAALQMGNEGHFVWVLNSENKVSKHLVTPGIQDSQ
KVVIRAGISAGDRVVTDGIDRLTEGAKVEVVEAQSATTPEEKATSREYAKKGARS

>gb|U00096.1|+|2154016-2155263|mdtA [Escherichia coli str. K-12 substr. MG1655]
ATGAAAGGTAGTTATAAATCCCGTTGGGTAATCGTAATCGTGGTGGTTATCGCCGCCATCGCCGCATTCTGGTTCTGGCAAGGCCGCAAT
GACTCCCGGAGTGCAGCCCCAGGGGCGACGAAACAAGCGCAGCAATCGCCAGCGGGTGGTCGACGTGGTATGCGTTCCGGCCCATTAGCC
CCGGTTCAGGCGGCGACCGCCGTAGAACAGGCAGTTCCGCGTTACCTCACCGGGCTTGGCACCATTACCGCCGCTAATACCGTTACGGTG
CGCAGCCGCGTGGACGGCCAACTGATAGCGTTACATTTCCAGGAAGGCCAGCAGGTCAAAGCAGGCGATTTACTGGCAGAAATTGACCCC
AGCCAGTTCAAAGTTGCATTAGCACAAGCCCAGGGCCAACTGGCAAAAGATAAAGCCACGCTTGCCAACGCCCGCCGTGACCTGGCGCGT
TATCAACAACTGGCAAAAACCAATCTCGTTTCCCGCCAGGAGCTGGATGCCCAACAGGCGCTGGTCAGTGAAACCGAAGGCACCATTAAG
GCTGATGAAGCAAGCGTTGCCAGCGCGCAGCTGCAACTCGACTGGAGCCGGATTACCGCACCAGTCGATGGTCGCGTTGGTCTCAAGCAG
GTTGATGTTGGTAACCAAATCTCCAGTGGTGATACCACCGGGATCGTGGTGATCACCCAGACGCATCCTATCGATTTAGTCTTTACCCTG
CCGGAAAGCGATATCGCTACCGTAGTGCAGGCGCAGAAAGCCGGAAAACCGCTGGTGGTAGAAGCCTGGGATCGCACCAACTCGAAGAAA
TTAAGTGAAGGCACGCTGTTAAGTCTAGATAACCAAATCGATGCCACTACCGGTACGATTAAAGTGAAAGCACGCTTTAATAATCAGGAT
GATGCGCTGTTTCCCAATCAGTTTGTTAACGCGCGCATGTTAGTCGACACCGAACAAAACGCCGTAGTGATCCCAACAGCCGCCCTGCAA
ATGGGCAATGAAGGCCATTTTGTCTGGGTGCTGAATAGCGAAAACAAGGTCAGCAAACATCTGGTGACGCCGGGCATTCAGGACAGTCAG
AAAGTGGTGATCCGTGCAGGTATTTCTGCGGGCGATCGCGTGGTGACAGACGGCATTGATCGCCTGACCGAAGGGGCGAAAGTGGAAGTG
GTGGAAGCCCAGAGCGCCACTACTCCGGAAGAGAAAGCCACCAGCCGCGAATACGCGAAAAAAGGAGCACGCTCCTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

mdtA

Prevalence: protein homolog model (view sequences)

Graph