mdtH

Accession ARO:3001216
CARD Short NamemdtH
DefinitionMultidrug resistance protein MdtH.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesEscherichia colig+p+wgs, Escherichia fergusoniiwgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Acinetobacter indicuswgs, Bacillus velezensiswgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterococcus faeciumwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Legionella pneumophilawgs, Listeria monocytogeneswgs, Mycobacterium aviumwgs, Neisseria gonorrhoeaewgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Pseudomonas syringaewgs, Salmonella entericag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs, Staphylococcus pseudintermediuswgs, Stenotrophomonas maltophiliawgs, Streptobacillus moniliformiswgs
Classification7 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic enoxacin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Publications

Li XZ and Nikaido H. 2009. Drugs 69(12): 1555-1623. Efflux-mediated drug resistance in bacteria: an update. (PMID 19678712)

Hirakawa H, et al. 2005. Mol. Microbiol. 55(4):1113-26 Indole induces the expression of multidrug exporter genes in Escherichia coli. (PMID 15686558)

Resistomes

Prevalence of mdtH among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.02%0%
Acinetobacter indicus0%0%1.39%0%
Bacillus velezensis0%0%0.46%0%
Citrobacter freundii0%0%0.48%0%
Citrobacter koseri0%0%1.04%0%
Enterobacter cloacae0%0%0.36%0%
Enterobacter hormaechei0%0%0.09%0%
Enterococcus faecium0%0%0.04%0%
Escherichia albertii100%0%94.62%0%
Escherichia coli64.4%0.01%68.34%0%
Escherichia fergusonii5.26%0%1.41%0%
Escherichia marmotae100%0%69.57%0%
Klebsiella pneumoniae0%0%0.09%0%
Klebsiella quasipneumoniae0%0%0.16%0%
Legionella pneumophila0%0%0.12%0%
Listeria monocytogenes0%0%0.03%0%
Mycobacterium avium0%0%0.96%0%
Neisseria gonorrhoeae0%0%0.12%0%
Providencia rettgeri0%0%0.74%0%
Pseudomonas aeruginosa0%0%0.08%0%
Pseudomonas syringae0%0%0.53%0%
Salmonella enterica0.73%0%0.59%0%
Shigella boydii100%0%98.9%0%
Shigella dysenteriae100%0%100%0%
Shigella flexneri100%0%82.14%0%
Shigella sonnei100%0%96.07%0%
Staphylococcus pseudintermedius0%0%0.53%0%
Stenotrophomonas maltophilia0%0%0.17%0%
Streptobacillus moniliformis0%0%4.76%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 750


>gb|AAC74149.2|-|mdtH [Escherichia coli str. K-12 substr. MG1655]
MSRVSQARNLGKYFLLIDNMLVVLGFFVVFPLISIRFVDQMGWAAVMVGIALGLRQFIQQGLGIFGGAIADRFGAKPMIVTGMLMRAAGF
ATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFFSLLMMQDSAGAVIGALLGSWLLQYDFRLVCATGAVLFVLCAAF
NAWLLPAWKLSTVRTPVREGMTRVMRDKRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAIEACLSLTLLYPIARWSEKH
FRLEHRLMAGLLIMSLSMMPVGMVSGLQQLFTLICLFYIGSIIAEPARETLSASLADARARGSYMGFSRLGLAIGGAIGYIGGGWLFDLG
KSAHQPELPWMMLGIIGIFTFLALGWQFSQKRAARRLLERDA


>gb|U00096.1|-|1124118-1125326|mdtH [Escherichia coli str. K-12 substr. MG1655]
ATGTCCCGCGTGTCGCAGGCGAGGAACCTGGGTAAATATTTCCTGCTCATCGATAATATGCTGGTCGTGCTGGGGTTCTTTGTTGTCTTC
CCGCTGATCTCTATCCGCTTCGTTGATCAAATGGGCTGGGCCGCCGTCATGGTCGGTATTGCTCTCGGTCTACGCCAATTTATTCAGCAA
GGTCTGGGTATTTTCGGCGGTGCAATTGCCGACCGCTTTGGTGCCAAACCGATGATTGTTACCGGTATGCTGATGCGCGCCGCCGGATTC
GCCACAATGGGTATCGCCCACGAACCGTGGCTATTGTGGTTTTCATGCCTGCTCTCGGGACTCGGTGGCACGTTGTTTGATCCGCCGCGT
TCGGCGCTGGTGGTGAAATTAATCCGTCCACAGCAGCGTGGTCGTTTTTTCTCGCTGTTGATGATGCAGGACAGTGCCGGTGCGGTCATT
GGCGCATTGTTGGGGAGCTGGCTGTTGCAATACGACTTTCGCCTGGTCTGCGCCACAGGGGCAGTTCTATTTGTGCTATGTGCGGCGTTC
AATGCGTGGTTGTTACCAGCATGGAAACTCTCCACCGTACGCACGCCCGTTCGCGAAGGCATGACCCGCGTGATGCGTGACAAGCGTTTT
GTCACCTATGTTCTGACGCTGGCGGGTTACTACATGCTGGCTGTACAAGTGATGCTGATGCTGCCAATTATGGTCAACGACGTGGCTGGC
GCGCCCTCTGCCGTTAAATGGATGTATGCCATTGAAGCGTGTCTGTCGTTAACGTTGCTCTACCCTATCGCCCGCTGGAGTGAAAAGCAT
TTTCGTCTGGAACACCGGTTGATGGCTGGGCTGTTGATAATGTCATTAAGCATGATGCCGGTGGGCATGGTCAGCGGCCTGCAACAACTT
TTCACCCTGATTTGTCTGTTTTATATCGGGTCGATCATTGCCGAGCCTGCGCGTGAAACCTTAAGTGCTTCGCTGGCGGACGCAAGAGCT
CGCGGCAGCTATATGGGGTTTAGCCGTCTGGGTCTGGCGATTGGCGGCGCTATTGGTTATATCGGTGGCGGCTGGCTGTTTGACCTGGGC
AAATCGGCGCACCAGCCAGAGCTTCCGTGGATGATGCTGGGCATTATTGGCATCTTCACTTTCCTTGCGCTGGGTTGGCAGTTTAGCCAG
AAACGCGCCGCGCGTCGTTTGCTTGAACGCGACGCCTGA