mdtH

Accession ARO:3001216
DefinitionMultidrug resistance protein MdtH
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, lincosamide antibiotic, cephalosporin, phenicol antibiotic, fluoroquinolone antibiotic, penam, rhodamine, benzalkonium chloride, macrolide antibiotic, glycylcycline, peptide antibiotic, diaminopyrimidine antibiotic, acridine dye, bicyclomycin, oxazolidinone antibiotic, rifamycin antibiotic, antibacterial free fatty acids, fosfomycin, nucleoside antibiotic, isoniazid, nitroimidazole antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesEscherichia colig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneiwgs
Classification30 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic enoxacin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Publications

Li XZ and Nikaido H. 2009. Drugs 69(12): 1555-1623. Efflux-mediated drug resistance in bacteria: an update. (PMID 19678712)

Hirakawa H, et al. 2005. Mol. Microbiol. 55(4):1113-26 Indole induces the expression of multidrug exporter genes in Escherichia coli. (PMID 15686558)

Resistomes

Prevalence of mdtH among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.04%
Citrobacter freundii0%0%0.78%
Citrobacter koseri0%0%4.17%
Enterobacter cloacae0%0%0.23%
Enterococcus faecium0%0%0.07%
Escherichia coli13.02%0%86.45%
Klebsiella oxytoca0%0%0.93%
Klebsiella pneumoniae0%0%0%
Legionella pneumophila0%0%0.14%
Listeria monocytogenes0%0%0.04%
Neisseria gonorrhoeae0%0%0.17%
Pseudomonas aeruginosa0%0%0%
Salmonella enterica0.78%0%1.75%
Shigella dysenteriae100%0%100%
Shigella flexneri100%0%99.48%
Shigella sonnei100%0%99.84%
Staphylococcus pseudintermedius0%0%1.02%
Stenotrophomonas maltophilia0%0%0.33%
Yersinia enterocolitica0%0%0.65%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 750


>gb|AAC74149.2|-|mdtH [Escherichia coli str. K-12 substr. MG1655]
MSRVSQARNLGKYFLLIDNMLVVLGFFVVFPLISIRFVDQMGWAAVMVGIALGLRQFIQQGLGIFGGAIADRFGAKPMIVTGMLMRAAGF
ATMGIAHEPWLLWFSCLLSGLGGTLFDPPRSALVVKLIRPQQRGRFFSLLMMQDSAGAVIGALLGSWLLQYDFRLVCATGAVLFVLCAAF
NAWLLPAWKLSTVRTPVREGMTRVMRDKRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAGAPSAVKWMYAIEACLSLTLLYPIARWSEKH
FRLEHRLMAGLLIMSLSMMPVGMVSGLQQLFTLICLFYIGSIIAEPARETLSASLADARARGSYMGFSRLGLAIGGAIGYIGGGWLFDLG
KSAHQPELPWMMLGIIGIFTFLALGWQFSQKRAARRLLERDA


>gb|U00096|-|1124118-1125326|mdtH [Escherichia coli str. K-12 substr. MG1655]
ATGTCCCGCGTGTCGCAGGCGAGGAACCTGGGTAAATATTTCCTGCTCATCGATAATATGCTGGTCGTGCTGGGGTTCTTTGTTGTCTTC
CCGCTGATCTCTATCCGCTTCGTTGATCAAATGGGCTGGGCCGCCGTCATGGTCGGTATTGCTCTCGGTCTACGCCAATTTATTCAGCAA
GGTCTGGGTATTTTCGGCGGTGCAATTGCCGACCGCTTTGGTGCCAAACCGATGATTGTTACCGGTATGCTGATGCGCGCCGCCGGATTC
GCCACAATGGGTATCGCCCACGAACCGTGGCTATTGTGGTTTTCATGCCTGCTCTCGGGACTCGGTGGCACGTTGTTTGATCCGCCGCGT
TCGGCGCTGGTGGTGAAATTAATCCGTCCACAGCAGCGTGGTCGTTTTTTCTCGCTGTTGATGATGCAGGACAGTGCCGGTGCGGTCATT
GGCGCATTGTTGGGGAGCTGGCTGTTGCAATACGACTTTCGCCTGGTCTGCGCCACAGGGGCAGTTCTATTTGTGCTATGTGCGGCGTTC
AATGCGTGGTTGTTACCAGCATGGAAACTCTCCACCGTACGCACGCCCGTTCGCGAAGGCATGACCCGCGTGATGCGTGACAAGCGTTTT
GTCACCTATGTTCTGACGCTGGCGGGTTACTACATGCTGGCTGTACAAGTGATGCTGATGCTGCCAATTATGGTCAACGACGTGGCTGGC
GCGCCCTCTGCCGTTAAATGGATGTATGCCATTGAAGCGTGTCTGTCGTTAACGTTGCTCTACCCTATCGCCCGCTGGAGTGAAAAGCAT
TTTCGTCTGGAACACCGGTTGATGGCTGGGCTGTTGATAATGTCATTAAGCATGATGCCGGTGGGCATGGTCAGCGGCCTGCAACAACTT
TTCACCCTGATTTGTCTGTTTTATATCGGGTCGATCATTGCCGAGCCTGCGCGTGAAACCTTAAGTGCTTCGCTGGCGGACGCAAGAGCT
CGCGGCAGCTATATGGGGTTTAGCCGTCTGGGTCTGGCGATTGGCGGCGCTATTGGTTATATCGGTGGCGGCTGGCTGTTTGACCTGGGC
AAATCGGCGCACCAGCCAGAGCTTCCGTGGATGATGCTGGGCATTATTGGCATCTTCACTTTCCTTGCGCTGGGTTGGCAGTTTAGCCAG
AAACGCGCCGCGCGTCGTTTGCTTGAACGCGACGCCTGA