Escherichia coli mdfA

Accession ARO:3001328
Synonym(s)cmlA cmr
CARD Short NameEcol_mdfA
DefinitionMultidrug efflux pump in E. coli. This multidrug efflux system was originally identified as the Cmr/CmlA chloramphenicol exporter.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classdisinfecting agents and antiseptics, tetracycline antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Citrobacter amalonaticusg+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter roggenkampiiwgs, Escherichia albertiig+wgs, Escherichia colig+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella oxytocap, Klebsiella pneumoniaewgs, Listeria monocytogeneswgs, Pseudomonas aeruginosawgs, Salmonella entericag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs, Staphylococcus aureuswgs, Stenotrophomonas maltophiliawgs
Classification8 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic benzalkonium chloride [Antibiotic]
Publications

Heng J, et al. 2015. Cell Res. 25(9):1060-73 Substrate-bound structure of the E. coli multidrug resistance transporter MdfA. (PMID 26238402)

Bohn C, et al. 1998. J. Bacteriol. 180(22):6072-5 The Escherichia coli cmlA gene encodes the multidrug efflux pump Cmr/MdfA and is responsible for isopropyl-beta-D-thiogalactopyranoside exclusion and spectinomycin sensitivity. (PMID 9811673)

Resistomes

Prevalence of Escherichia coli mdfA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.02%0%
Citrobacter amalonaticus100%0%85.42%0%
Citrobacter freundii93.85%0.26%56.71%0%
Citrobacter koseri100%0%46.67%0%
Citrobacter portucalensis100%0%84%0%
Citrobacter werkmanii100%0%100%0%
Citrobacter youngae100%0%92.86%0%
Enterobacter hormaechei0.6%0.17%0.83%0%
Enterobacter roggenkampii0%0%1.21%0%
Escherichia albertii100%0%96.55%0%
Escherichia coli61.46%0%74.65%0%
Escherichia fergusonii100%0%43.08%0%
Escherichia marmotae100%0%69.05%0%
Klebsiella oxytoca0%0.95%0%0%
Klebsiella pneumoniae0%0%0.05%0%
Listeria monocytogenes0%0%0.03%0%
Pseudomonas aeruginosa0%0%0.02%0%
Salmonella enterica86.16%0%76.75%0%
Shigella boydii100%0%95.7%0%
Shigella dysenteriae90.91%0%96.43%0%
Shigella flexneri100%0%83.33%0%
Shigella sonnei100%0%95.19%0%
Staphylococcus aureus0%0%0.01%0%
Stenotrophomonas maltophilia0%0%0.2%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|AFH35853.1|+|Escherichia coli mdfA [Escherichia coli]
MQNKLASGARLGRQALLFPLCLVLYEFSTYIGNDMRQPGMLENVEQYQAGIEWVPTSMNAYLAGGMFIQWLLGPLSDRIGRRPVMLAGVV
WFIVTCLAILLAQNIEQFTLLRFLHGISLCFIGAVGYDAIQESFEEAVCIKITALMANVALIAPLLGPLVGASWIHVLPWEGMFVLFAAL
AAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFVAGALALGFLSLPLLAWIAQSPIIIITGEQLSSYEYGLLQVPIFGALIA
GNLLLARLTSRRTVRSLIIMGGWPIMIGLLVAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLFASVMSKGTVSAAMGMLQMLI
FTVGIEISKHAWLNGGNGLFNLFNLVNGILLLSLMVIFLKDKQMGNSHEG


>gb|JQ394987.1|+|1-1233|Escherichia coli mdfA [Escherichia coli]
ATGCAAAATAAATTAGCTTCCGGTGCCAGGCTTGGACGTCAGGCGTTACTTTTTCCTCTCTGTCTGGTGCTTTACGAATTTTCAACCTAT
ATCGGCAACGATATGAGGCAACCCGGTATGTTGGAAAATGTGGAACAATATCAGGCGGGCATTGAGTGGGTTCCTACTTCGATGAACGCG
TATCTGGCGGGCGGGATGTTTATACAATGGCTGCTGGGGCCGCTGTCGGATCGTATTGGTCGTCGTCCGGTGATGCTGGCGGGAGTGGTG
TGGTTTATCGTCACATGTCTGGCAATATTGCTGGCGCAAAACATTGAACAATTCACCCTGTTGCGCTTCTTGCACGGCATAAGCCTCTGT
TTCATTGGCGCTGTGGGATACGACGCAATTCAGGAATCCTTCGAAGAGGCGGTTTGTATCAAGATCACCGCGCTGATGGCGAACGTGGCG
CTGATTGCTCCGCTACTTGGTCCGCTGGTGGGCGCGTCGTGGATCCATGTGCTGCCCTGGGAGGGGATGTTTGTTTTGTTTGCCGCATTG
GCAGCGATCTCCTTTTTCGGTCTGCAACGGGCCATGCCTGAAACCGCCACGCGTATAGGCGAGAAACTGTCACTGAAAGAACTCGGTCGT
GACTATAAGCTGGTGCTGAAGAACGGCCGCTTTGTGGCGGGGGCGCTGGCGCTGGGATTCCTTAGTCTGCCGTTGCTGGCGTGGATCGCC
CAGTCGCCGATTATCATCATTACCGGCGAGCAGTTGAGCAGCTATGAATATGGCTTGCTGCAAGTGCCTATTTTCGGGGCGTTAATTGCG
GGTAACTTGCTGTTAGCGCGTCTGACCTCGCGCCGCACCGTACGTTCGCTGATTATTATGGGCGGCTGGCCGATTATGATTGGTCTATTG
GTCGCTGCTGCGGCAACGGTTATCTCATCGCACGCGTATTTATGGATGACTGCCGGGTTAAGTATTTATGCTTTCGGTATTGGTCTGGCG
AATGCGGGACTGGTGCGATTAACCCTGTTTGCCAGCGTTATGAGTAAAGGTACGGTTTCTGCCGCGATGGGAATGCTGCAAATGCTGATC
TTTACCGTTGGTATTGAAATCAGCAAACATGCCTGGCTGAACGGGGGCAACGGACTGTTTAATCTCTTCAACCTTGTCAACGGAATTTTG
TTGCTGTCGCTGATGGTTATCTTTTTAAAAGATAAACAGATGGGAAATTCTCACGAAGGGTAA