IMI-3

Accession ARO:3001860
DefinitionIMI-3 is a beta-lactamase found in Enterobacteriaceae
AMR Gene FamilyIMI beta-lactamase
Drug Classcarbapenem
Resistance Mechanismantibiotic inactivation
Classification13 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ IMI beta-lactamase [AMR Gene Family]
Publications

Chu YW, et al. 2011. Emerg Infect Dis 17(1): 130-132. Carbapenemases in enterobacteria, Hong Kong, China, 2009. (PMID 21192875)

Resistomes

Prevalence of IMI-3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 85 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 550


>gb|ACX71212.1|+|IMI-3 [Enterobacter cloacae]
MSLNVKQSRIAILFISCLFSISFFSQANTKGIDEIKNLETDFNGRVGVYALDTGSGKSFSYKANERFPLCSSFKGFLAAAVLKGSQDNQL
NLNQIVNYNTRSLEFHSPITTKYKDNGMSLGDMAAAALQYSDNGATNIILERYIGGPEGMTKFMRSIGDEDFRLDRWELDLNTAIPGDER
DTSTPAAVAKSLKTLALGNILSEREKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSCGAYGTANDYAVVWPKNRAPLIISVYTTKNE
KEAKHEDKVIAEASRIAIDNLK


>gb|GU015024|+|1-879|IMI-3 [Enterobacter cloacae]
ATGTCACTTAATGTAAAACAAAGTAGAATAGCCATCTTGTTTATCTCTTGTTTATTTTCAATATCATTTTTCTCACAGGCCAATACAAAG
GGTATCGATGAGATTAAAAACCTTGAAACAGATTTCAATGGTAGAGTTGGTGTCTACGCTTTAGACACTGGCTCAGGTAAATCATTTTCG
TACAAAGCAAATGAACGATTTCCATTATGTAGTTCTTTCAAAGGCTTTTTAGCTGCTGCTGTATTAAAAGGCTCTCAAGATAATCAACTC
AATCTTAATCAGATCGTGAATTACAATACAAGAAGTTTAGAGTTCCATTCACCCATCACAACTAAATATAAAGATAATGGAATGTCATTA
GGTGATATGGCTGCTGCCGCTTTACAATATAGCGACAATGGTGCTACTAATATTATTCTTGAACGTTATATCGGTGGTCCTGAGGGTATG
ACTAAATTCATGCGGTCGATTGGAGATGAAGATTTTAGACTCGATCGTTGGGAGTTAGATCTAAACACAGCTATTCCAGGCGATGAACGT
GACACATCTACACCTGCAGCAGTAGCTAAGAGCCTGAAAACTCTTGCTCTGGGTAACATACTTAGTGAGCGTGAAAAGGAAACCTATCAG
ACATGGTTAAAGGGTAACACAACCGGTGCAGCGCGTATTCGTGCTAGCGTACCAAGCGATTGGGTAGTTGGCGATAAAACTGGTAGTTGC
GGAGCATACGGTACTGCAAATGATTATGCGGTAGTCTGGCCAAAGAACCGGGCTCCTCTTATAATTTCTGTATACACAACAAAAAACGAA
AAAGAAGCCAAGCATGAGGATAAAGTAATCGCAGAAGCTTCAAGAATYGCAATTGATAACCTTAAATAA