CTX-M-1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001864
Synonym(s)MEN-1
CARD Short NameCTX-M-1
DefinitionCTX-M-1 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene FamilyCTX-M beta-lactamase
Drug Classazole antibiotic, imidazole antibiotic, cephalosporin
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (118), Klebsiella pneumoniae (19), Salmonella (10), Enterobacteriaceae (8), Klebsiella oxytoca (8), Proteus mirabilis (5), Salmonella enterica (5), Enterobacter cloacae (3), Citrobacter freundii (2), Citrobacter (2)
GAZEurope (4), Germany (3), Kingdom of Spain (3), [Former] State of Korea (3), Unity State (2), Poland (2), Kingdom of Denmark (2), China (2), The Netherlands (2), Tunisia (2)
FOODONswine (18), poultry drumstick (14), chicken (12), meat (skinless) (7), Bos taurus (4), water food product (3), turkey (bird) (2)
ENVOfarm (13), hospital (5)
UBERONanimal hemisphere (11), feces (11), renal system (2), blood (2)
Classification14 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ CTX-M beta-lactamase [AMR Gene Family]
Sub-Term(s)
2 ontology terms | Show
+ tazobactam [Adjuvant] is_small_molecule_inhibitor_of
+ clavulanic acid [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesEscherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Proteus mirabiliswgs, Salmonella entericawgs, Shigella flexneriwgs, Shigella sonneiwgs
Resistomes with Sequence VariantsEscherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Proteus mirabiliswgs, Salmonella entericawgs, Shigella flexneriwgs, Shigella sonneiwgs
Publications

Bauernfeind A, et al. 1996. Antimicrob Agents Chemother 40(2): 509-513. Sequences of beta-lactamase genes encoding CTX-M-1 (MEN-1) and CTX-M-2 and relationship of their amino acid sequences with those of other beta-lactamases. (PMID 8834913)

Resistomes

Prevalence of CTX-M-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Escherichia coli0.1%0.32%2.13%0%0.71%
Escherichia fergusonii0%0%2.17%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella michiganensis0%2.29%0%0%0%
Klebsiella oxytoca0%0%2.1%0%0%
Klebsiella pneumoniae0%0.01%0.12%0%0%
Proteus mirabilis0%0%0.33%0%0%
Salmonella enterica0%0%0.03%0%0%
Shigella flexneri0%0%0.16%0%0%
Shigella sonnei0%0%0.15%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAA63262.1|+|CTX-M-1 [Escherichia coli]
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESE
PNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP
RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQ
PKAESRRDVLASAAKIVTNGL


>gb|X92506.1|+|1-876|CTX-M-1 [Escherichia coli]
ATGGTTAAAAAATCACTGCGTCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACG
GCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGAAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAA
ATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGTGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAA
CCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACTTGGTTAACTATAATCCGATTGCGGAAAAGCACGTCGATGGGACGATG
TCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTTCTCACGTTGGCGGCCCGGCTAGC
GTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCG
CGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGTAATCTGACGCTGGGTAAAGCATTGGGTGACAGCCAACGGGCGCAGCTG
GTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGC
GGTGACTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAA
CCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCAACGGTTTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit