DHA-1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002132
CARD Short NameDHA-1
DefinitionDHA-1 is a class C beta-lactamase found in Morganella morganii and Salmonella enterica.
AMR Gene FamilyDHA beta-lactamase
Drug Classcephalosporin
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (56), Escherichia coli (30), Salmonella (11), Enterobacter cloacae (7), Enterobacteriaceae (6), Klebsiella (4), Proteus mirabilis (3), Klebsiella oxytoca (3), Morganella morganii (2), Enterobacter (2)
GAZKingdom of Spain (3), China (2), Republic of China (2)
FOODON
ENVOhospital (4)
UBERONanimal hemisphere (2), blood (2)
Classification12 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ DHA beta-lactamase [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ vaborbactam [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAcinetobacter indicusp, Citrobacter amalonaticusp, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+gi, Morganella morganiig+wgs, Proteus mirabilisg+p+wgs+gi, Proteus vulgariswgs, Providencia rettgerig+p+wgs, Providencia stuartiig+gi, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneip+gi, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter indicusp, Citrobacter amalonaticusp, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+gi, Morganella morganiig+wgs, Proteus mirabilisg+p+wgs+gi, Proteus vulgariswgs, Providencia rettgerig+p+wgs, Providencia stuartiig+gi, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneip+gi, Vibrio choleraewgs
Publications

Barnaud G, et al. 1998. Antimicrob Agents Chemother 42(9): 2352-2358. Salmonella enteritidis: AmpC plasmid-mediated inducible beta-lactamase (DHA-1) with an ampR gene from Morganella morganii. (PMID 9736562)

Resistomes

Prevalence of DHA-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter indicus0%1.89%0%0%0%
Citrobacter amalonaticus0%8.33%0%0%0%
Citrobacter freundii0%1.54%3.48%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%1.47%0%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0.55%0.79%0%0%
Enterobacter chengduensis0%0%8%0%0%
Enterobacter cloacae0%0%3.19%0%0%
Enterobacter hormaechei0%1.03%3.93%0%0%
Enterobacter kobei0%0.69%2.18%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli0.05%0.04%0.37%0%0%
Klebsiella aerogenes0%1.09%0.28%0%0%
Klebsiella michiganensis0%1.14%1.33%0%0%
Klebsiella oxytoca2.56%0%1.26%0%0%
Klebsiella pneumoniae0.59%1.31%3.44%0%0%
Klebsiella quasipneumoniae0%1.69%7.89%0%0%
Leclercia adecarboxylata7.14%0%0%50%0%
Morganella morganii23.08%0%20.25%0%0%
Proteus mirabilis2.75%1.25%4.46%3.7%0%
Proteus vulgaris0%0%5.56%0%0%
Providencia rettgeri2.94%5.41%0.64%0%0%
Providencia stuartii6.25%0%0%33.33%0%
Raoultella planticola0%2.33%2.56%0%0%
Salmonella enterica0.13%0.77%0.56%0%0%
Serratia marcescens0%0%0.13%0%0%
Shigella boydii0%0%1.11%0%0%
Shigella flexneri0%0%0.16%0%0%
Shigella sonnei0%0.97%0%4.76%0%
Vibrio cholerae0%0%0.06%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700


>gb|CAA76196.1|+|DHA-1 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYFNYGFADIQAKQPVTENTLFELGSVSKTFTG
VLGAVSVAKKEMALNDPAAKYQPELALPQWKGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL
TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESYGVKSASKDMLRWAEMNMEPSRAGNADLEMA
MYLAQTRYYKTAAINQGLGWEMYDWPQQKDMIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK
NYPNTERVKAAQAILSALE


>gb|Y16410.1|+|987-2126|DHA-1 [Salmonella enterica subsp. enterica serovar Enteritidis]
ATGAAAAAATCGTTATCTGCAACACTGATTTCCGCTCTGCTGGCGTTTTCCGCCCCGGGGTTTTCTGCCGCTGATAATGTCGCGGCGGTG
GTGGACAGCACCATTAAACCGCTGATGGCACAGCAGGATATTCCCGGGATGGCGGTTGCCGTCTCCGTAAAGGGTAAGCCCTATTATTTC
AATTATGGTTTTGCCGATATTCAGGCAAAACAGCCGGTCACTGAAAATACACTATTTGAGCTCGGATCTGTAAGTAAAACTTTCACAGGT
GTGCTGGGTGCGGTTTCTGTGGCGAAAAAAGAGATGGCGCTGAATGATCCGGCGGCAAAATACCAGCCGGAGCTGGCTCTGCCGCAGTGG
AAGGGGATCACATTGCTGGATCTGGCTACCTATACCGCAGGCGGACTGCCGTTACAGGTGCCGGATGCGGTAAAAAGCCGTGCGGATCTG
CTGAATTTCTATCAGCAGTGGCAGCCGTCCCGGAAACCGGGCGATATGCGTCTGTATGCAAACAGCAGTATCGGCCTGTTTGGTGCTCTG
ACCGCAAACGCGGCGGGGATGCCGTATGAGCAGTTGCTGACTGCACGGATCCTGGCACCGCTGGGGTTATCTCACACCTTTATTACTGTG
CCGGAAAGTGCGCAAAGCCAGTATGCGTACGGTTATAAAAACAAAAAACCGGTCCGCGTGTCGCCGGGACAGCTTGATGCGGAATCTTAC
GGCGTGAAATCCGCCTCAAAAGATATGCTGCGCTGGGCGGAAATGAATATGGAGCCGTCACGGGCCGGTAATGCGGATCTGGAAATGGCA
ATGTATCTCGCCCAGACCCGCTACTATAAAACCGCCGCGATTAACCAGGGGCTGGGCTGGGAAATGTATGACTGGCCGCAGCAGAAAGAT
ATGATCATTAACGGTGTGACCAACGAGGTCGCATTGCAGCCGCATCCGGTAACAGACAACCAGGTTCAGCCGTATAACCGTGCTTCCTGG
GTGCATAAAACGGGCGCAACAACTGGTTTCGGCGCCTATGTCGCCTTTATTCCGGAAAAACAGGTGGCGATTGTGATTCTGGCGAATAAA
AACTACCCGAATACCGAAAGAGTCAAAGCTGCACAGGCTATTTTGAGTGCACTGGAATAA

Curator Acknowledgements
Curator Description Most Recent Edit