DHA-1

Download Sequences

Accession	ARO:3002132
CARD Short Name	DHA-1
Definition	DHA-1 is a class C beta-lactamase found in Morganella morganii and Salmonella enterica.
AMR Gene Family	DHA beta-lactamase
Drug Class	cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter indicus^p, Citrobacter amalonaticus^p, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p, Citrobacter youngae^wgs, Enterobacter asburiae^p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+gi, Morganella morganii^g+wgs, Proteus mirabilis^g+p+wgs+gi, Proteus vulgaris^wgs, Providencia rettgeri^g+p+wgs, Providencia stuartii^g+gi, Raoultella planticola^p+wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^wgs, Shigella boydii^wgs, Shigella flexneri^wgs, Shigella sonnei^p+gi, Vibrio cholerae^wgs
Resistomes with Sequence Variants	Acinetobacter indicus^p, Citrobacter amalonaticus^p, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p, Citrobacter youngae^wgs, Enterobacter asburiae^p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+gi, Morganella morganii^g+wgs, Proteus mirabilis^g+p+wgs+gi, Proteus vulgaris^wgs, Providencia rettgeri^g+p+wgs, Providencia stuartii^g+gi, Raoultella planticola^p+wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^wgs, Shigella boydii^wgs, Shigella flexneri^wgs, Shigella sonnei^p+gi, Vibrio cholerae^wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + antibiotic molecule + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactam antibiotic + beta-lactamase + class C beta-lactamase + cephalosporin [Drug Class]
Parent Term(s)	1 ontology terms \| Show + DHA beta-lactamase [AMR Gene Family]
Sub-Term(s)	1 ontology terms \| Show + vaborbactam [Adjuvant] is_small_molecule_inhibitor
Publications	Barnaud G, et al. 1998. Antimicrob Agents Chemother 42(9): 2352-2358. Salmonella enteritidis: AmpC plasmid-mediated inducible beta-lactamase (DHA-1) with an ampR gene from Morganella morganii. (PMID 9736562)

Resistomes

Prevalence of DHA-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter indicus	0%	1.89%	0%	0%	0%
Acinetobacter indicus	0%	1.89%	0%	0%	0%
Citrobacter amalonaticus	0%	8.33%	0%	0%	0%
Citrobacter amalonaticus	0%	8.33%	0%	0%	0%
Citrobacter freundii	0%	1.54%	3.48%	0%	0%
Citrobacter freundii	0%	1.54%	3.48%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	1.47%	0%	0%	0%
Citrobacter portucalensis	0%	1.47%	0%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Enterobacter asburiae	0%	0.55%	0.79%	0%	0%
Enterobacter asburiae	0%	0.55%	0.79%	0%	0%
Enterobacter chengduensis	0%	0%	8%	0%	0%
Enterobacter chengduensis	0%	0%	8%	0%	0%
Enterobacter cloacae	0%	0%	3.19%	0%	0%
Enterobacter cloacae	0%	0%	3.19%	0%	0%
Enterobacter hormaechei	0%	1.03%	3.93%	0%	0%
Enterobacter hormaechei	0%	0.97%	3.93%	0%	0%
Enterobacter kobei	0%	0.69%	2.18%	0%	0%
Enterobacter kobei	0%	0.69%	2.18%	0%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%	0%
Escherichia coli	0.05%	0.04%	0.37%	0%	0%
Escherichia coli	0.05%	0.04%	0.37%	0%	0%
Klebsiella aerogenes	0%	1.09%	0.28%	0%	0%
Klebsiella aerogenes	0%	1.09%	0.28%	0%	0%
Klebsiella michiganensis	0%	1.14%	1.33%	0%	0%
Klebsiella michiganensis	0%	1.14%	1.33%	0%	0%
Klebsiella oxytoca	2.56%	0%	1.26%	0%	0%
Klebsiella oxytoca	2.56%	0%	1.26%	0%	0%
Klebsiella pneumoniae	0.59%	1.31%	3.44%	0%	0%
Klebsiella pneumoniae	0.59%	1.31%	3.44%	0%	0%
Klebsiella quasipneumoniae	0%	1.69%	7.89%	0%	0%
Klebsiella quasipneumoniae	0%	1.69%	7.89%	0%	0%
Leclercia adecarboxylata	7.14%	0%	0%	50%	0%
Leclercia adecarboxylata	7.14%	0%	0%	50%	0%
Morganella morganii	19.23%	0%	18.4%	0%	0%
Morganella morganii	23.08%	0%	20.25%	0%	0%
Proteus mirabilis	2.75%	1.25%	4.46%	3.7%	0%
Proteus mirabilis	2.75%	1.25%	4.46%	3.7%	0%
Proteus vulgaris	0%	0%	5.56%	0%	0%
Proteus vulgaris	0%	0%	5.56%	0%	0%
Providencia rettgeri	2.94%	5.41%	0.64%	0%	0%
Providencia rettgeri	2.94%	5.41%	0.64%	0%	0%
Providencia stuartii	6.25%	0%	0%	33.33%	0%
Providencia stuartii	6.25%	0%	0%	33.33%	0%
Raoultella planticola	0%	2.33%	2.56%	0%	0%
Raoultella planticola	0%	2.33%	2.56%	0%	0%
Salmonella enterica	0.13%	0.77%	0.56%	0%	0%
Salmonella enterica	0.13%	0.77%	0.56%	0%	0%
Serratia marcescens	0%	0%	0.13%	0%	0%
Serratia marcescens	0%	0%	0.13%	0%	0%
Shigella boydii	0%	0%	1.11%	0%	0%
Shigella boydii	0%	0%	1.11%	0%	0%
Shigella flexneri	0%	0%	0.16%	0%	0%
Shigella flexneri	0%	0%	0.16%	0%	0%
Shigella sonnei	0%	0.97%	0%	4.76%	0%
Shigella sonnei	0%	0.97%	0%	4.76%	0%
Vibrio cholerae	0%	0%	0.06%	0%	0%
Vibrio cholerae	0%	0%	0.06%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700

Protein
DNA

>gb|CAA76196.1|+|DHA-1 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKKSLSATLISALLAFSAPGFSAADNVAAVVDSTIKPLMAQQDIPGMAVAVSVKGKPYYFNYGFADIQAKQPVTENTLFELGSVSKTFTG
VLGAVSVAKKEMALNDPAAKYQPELALPQWKGITLLDLATYTAGGLPLQVPDAVKSRADLLNFYQQWQPSRKPGDMRLYANSSIGLFGAL
TANAAGMPYEQLLTARILAPLGLSHTFITVPESAQSQYAYGYKNKKPVRVSPGQLDAESYGVKSASKDMLRWAEMNMEPSRAGNADLEMA
MYLAQTRYYKTAAINQGLGWEMYDWPQQKDMIINGVTNEVALQPHPVTDNQVQPYNRASWVHKTGATTGFGAYVAFIPEKQVAIVILANK
NYPNTERVKAAQAILSALE

>gb|Y16410.1|+|987-2126|DHA-1 [Salmonella enterica subsp. enterica serovar Enteritidis]
ATGAAAAAATCGTTATCTGCAACACTGATTTCCGCTCTGCTGGCGTTTTCCGCCCCGGGGTTTTCTGCCGCTGATAATGTCGCGGCGGTG
GTGGACAGCACCATTAAACCGCTGATGGCACAGCAGGATATTCCCGGGATGGCGGTTGCCGTCTCCGTAAAGGGTAAGCCCTATTATTTC
AATTATGGTTTTGCCGATATTCAGGCAAAACAGCCGGTCACTGAAAATACACTATTTGAGCTCGGATCTGTAAGTAAAACTTTCACAGGT
GTGCTGGGTGCGGTTTCTGTGGCGAAAAAAGAGATGGCGCTGAATGATCCGGCGGCAAAATACCAGCCGGAGCTGGCTCTGCCGCAGTGG
AAGGGGATCACATTGCTGGATCTGGCTACCTATACCGCAGGCGGACTGCCGTTACAGGTGCCGGATGCGGTAAAAAGCCGTGCGGATCTG
CTGAATTTCTATCAGCAGTGGCAGCCGTCCCGGAAACCGGGCGATATGCGTCTGTATGCAAACAGCAGTATCGGCCTGTTTGGTGCTCTG
ACCGCAAACGCGGCGGGGATGCCGTATGAGCAGTTGCTGACTGCACGGATCCTGGCACCGCTGGGGTTATCTCACACCTTTATTACTGTG
CCGGAAAGTGCGCAAAGCCAGTATGCGTACGGTTATAAAAACAAAAAACCGGTCCGCGTGTCGCCGGGACAGCTTGATGCGGAATCTTAC
GGCGTGAAATCCGCCTCAAAAGATATGCTGCGCTGGGCGGAAATGAATATGGAGCCGTCACGGGCCGGTAATGCGGATCTGGAAATGGCA
ATGTATCTCGCCCAGACCCGCTACTATAAAACCGCCGCGATTAACCAGGGGCTGGGCTGGGAAATGTATGACTGGCCGCAGCAGAAAGAT
ATGATCATTAACGGTGTGACCAACGAGGTCGCATTGCAGCCGCATCCGGTAACAGACAACCAGGTTCAGCCGTATAACCGTGCTTCCTGG
GTGCATAAAACGGGCGCAACAACTGGTTTCGGCGCCTATGTCGCCTTTATTCCGGAAAAACAGGTGGCGATTGTGATTCTGGCGAATAAA
AACTACCCGAATACCGAAAGAGTCAAAGCTGCACAGGCTATTTTGAGTGCACTGGAATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

DHA-1

Prevalence: protein homolog model (view sequences)

Graph