FOX-5

Download Sequences

Accession	ARO:3002159
Synonym(s)	FOX-6
CARD Short Name	FOX-5
Definition	FOX-5 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene Family	FOX beta-lactamase
Drug Class	cephamycin, cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter freundii^p+wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Salmonella enterica^wgs
Resistomes with Sequence Variants	Aeromonas veronii^g, Citrobacter freundii^p+wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^p+wgs, Salmonella enterica^wgs
Classification	14 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + beta-lactam antibiotic + cephem + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactamase + class C beta-lactamase + cephamycin [Drug Class] + cephalosporin [Drug Class]
Parent Term(s)	1 ontology terms \| Show + FOX beta-lactamase [AMR Gene Family]
Publications	Queenan AM, et al. 2001. Antimicrob Agents Chemother 45(11): 3189-3194. Cloning and biochemical characterization of FOX-5, an AmpC-type plasmid-encoded beta-lactamase from a New York City Klebsiella pneumoniae clinical isolate. (PMID 11600376)

Resistomes

Prevalence of FOX-5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Aeromonas veronii	1.82%	0%	0%	0%
Aeromonas veronii	0%	0%	0%	0%
Citrobacter freundii	0%	0.62%	0.77%	0%
Citrobacter freundii	0%	0.62%	0.77%	0%
Enterobacter cloacae	0%	0.56%	0.64%	0%
Enterobacter cloacae	0%	0.56%	0.64%	0%
Enterobacter hormaechei	0%	0%	0.35%	0%
Enterobacter hormaechei	0%	0%	0.35%	0%
Escherichia coli	0%	0.01%	0.02%	0%
Escherichia coli	0%	0.01%	0.02%	0%
Klebsiella michiganensis	0%	0.57%	0.8%	0%
Klebsiella michiganensis	0%	0.57%	0.8%	0%
Klebsiella oxytoca	0%	0.68%	0.42%	0%
Klebsiella oxytoca	0%	0.68%	0.42%	0%
Klebsiella pneumoniae	0%	0.05%	0.06%	0%
Klebsiella pneumoniae	0%	0.05%	0.06%	0%
Salmonella enterica	0%	0%	0.01%	0%
Salmonella enterica	0%	0%	0.01%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700

Protein
DNA

>gb|AAG12974.1|+|FOX-5 [Klebsiella pneumoniae]
MQQRRAFALLTLGSLLLAPCTYASGEAPLTAAVDGIIQPMLKAYRIPGMAVAVLKDGKAHYFNYGVANRESGQRVSEQTLFEIGSVSKTL
TATLGAYAAVKGGFELDDKVSQHAPWLKGSALDGVTMAELATYSAGGLPLQFPDEVDSNDKMRTYYRSWSPVYPAGTHRQYSNPSIGLFG
HLAANSLGQPFEQLMSQTLLPKLGLHHTYIQVPESAMVNYAYGYSKEDKPVRVTPGVLAAEAYGIKTGSADLLKFAEANMGYQGDAAVKS
AIALTHTGFYSVGDMTQGLGWESYAYPVTEQTLLAGNAPAVSFQANPVTRFAVPKAMGEQRLYNKTGSTGGFGAYVAFVPARGIAIVMLA
NRNYPIEARVKAAHAILSQLAE

>gb|AY007369.1|+|1-1149|FOX-5 [Klebsiella pneumoniae]
ATGCAACAACGGCGTGCGTTCGCGCTACTGACGCTGGGTAGCCTGCTGTTAGCCCCTTGTACTTATGCCAGCGGGGAGGCTCCGTTGACC
GCCGCTGTGGACGGCATTATCCAGCCGATGCTCAAGGCGTATCGGATCCCGGGGATGGCGGTCGCCGTACTGAAAGATGGCAAAGCCCAC
TATTTCAACTATGGGGTTGCCAACCGGGAGAGTGGCCAGCGCGTCAGCGAGCAGACCCTGTTCGAGATTGGCTCGGTCAGCAAGACCCTG
ACTGCGACCCTCGGTGCCTATGCCGCGGTCAAGGGGGGCTTTGAGCTGGATGACAAGGTGAGCCAGCACGCCCCCTGGCTCAAAGGTTCC
GCCTTGGATGGTGTGACCATGGCCGAGCTTGCCACCTACAGTGCGGGTGGTTTGCCGCTGCAGTTCCCCGATGAGGTGGATTCGAATGAC
AAGATGCGCACTTACTATCGGAGCTGGTCACCGGTTTATCCGGCGGGGACCCATCGCCAGTATTCCAACCCCAGCATCGGCCTGTTTGGT
CACCTGGCCGCAAATAGTCTGGGCCAGCCATTTGAGCAACTGATGAGCCAGACCCTGCTGCCCAAGCTGGGTTTGCACCACACCTATATC
CAGGTACCGGAGTCGGCTATGGTGAACTATGCCTACGGCTATTCGAAGGAAGATAAGCCCGTCCGGGTCACTCCGGGCGTGCTGGCAGCC
GAGGCTTACGGGATCAAGACCGGCTCGGCGGATCTGCTGAAGTTTGCCGAGGCAAACATGGGGTATCAGGGAGATGCCGCGGTAAAAAGC
GCGATCGCGCTGACCCACACCGGTTTCTACTCGGTGGGAGACATGACCCAGGGACTGGGCTGGGAGAGTTACGCCTATCCGGTGACCGAG
CAGACATTGCTGGCGGGTAACGCACCGGCGGTGAGCTTCCAGGCCAATCCGGTTACGCGCTTTGCGGTGCCCAAGGCGATGGGCGAGCAG
CGGCTCTATAACAAGACGGGCTCGACTGGCGGCTTTGGCGCCTATGTGGCGTTCGTGCCCGCCAGAGGGATCGCCATCGTCATGCTGGCC
AATCGCAACTATCCCATCGAGGCCAGGGTGAAGGCGGCTCACGCCATCCTGAGTCAGTTGGCCGAGTGA

FOX-5

Prevalence: protein homolog model (view sequences)

Graph