VEB-1

Download Sequences

Accession	ARO:3002370
CARD Short Name	VEB-1
Definition	VEB-1 is a beta-lactamase found in Escherichia coli and Pseudomonas aeruginosa.
AMR Gene Family	VEB beta-lactamase
Drug Class	cephalosporin, monobactam
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g+wgs, Aeromonas veronii^g+p+wgs, Enterobacter hormaechei^wgs, Escherichia coli^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Providencia rettgeri^wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^g+p+wgs, Vibrio alginolyticus^g+wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+wgs, Aeromonas veronii^g+p+wgs, Enterobacter hormaechei^wgs, Escherichia coli^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Providencia rettgeri^wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^g+p+wgs, Vibrio alginolyticus^g+wgs, Vibrio parahaemolyticus^wgs
Classification	13 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + antibiotic molecule + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactam antibiotic + beta-lactamase + class A beta-lactamase + cephalosporin [Drug Class] + monobactam [Drug Class]
Parent Term(s)	1 ontology terms \| Show + VEB beta-lactamase [AMR Gene Family]
Publications	Poirel L, et al. 1999. Antimicrob Agents Chemother 43(3): 573-581. Molecular and biochemical characterization of VEB-1, a novel class A extended-spectrum beta-lactamase encoded by an Escherichia coli integron gene. (PMID 10049269) Naas T, et al. 1999. FEMS Microbiol Lett 176(2): 411-419. Molecular characterization of In50, a class 1 integron encoding the gene for the extended-spectrum beta-lactamase VEB-1 in Pseudomonas aeruginosa. (PMID 10427724)

Resistomes

Prevalence of VEB-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0.18%	0%	0.13%	0%	0%
Acinetobacter baumannii	0.18%	0%	0.13%	0%	0%
Aeromonas veronii	1.82%	1.54%	1.12%	0%	0%
Aeromonas veronii	1.82%	1.54%	1.12%	0%	0%
Enterobacter hormaechei	0%	0%	0.04%	0%	0%
Enterobacter hormaechei	0%	0%	0.04%	0%	0%
Escherichia coli	0%	0%	0.02%	0%	0%
Escherichia coli	0%	0%	0.02%	0%	0%
Klebsiella pneumoniae	0%	0.1%	0.16%	0%	0%
Klebsiella pneumoniae	0%	0.1%	0.16%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.39%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.39%	0%	0%
Providencia rettgeri	0%	0%	7.64%	0%	0%
Providencia rettgeri	0%	0%	8.92%	0%	0%
Providencia stuartii	0%	0%	2.27%	0%	0%
Providencia stuartii	0%	0%	2.27%	0%	0%
Pseudomonas aeruginosa	0.15%	0.29%	0.13%	0%	0%
Pseudomonas aeruginosa	0.15%	0.29%	0.13%	0%	0%
Vibrio alginolyticus	1.23%	0%	0.4%	0%	0%
Vibrio alginolyticus	1.23%	0%	0.4%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550

Protein
DNA

>gb|CAM88398.1|-|VEB-1 [Acinetobacter baumannii AYE]
MKIVKRILLVLLSLFFTIVYSNAQTDNLTLKIENVLKAKNARIGVAIFNSNEKDTLKINNDFHFPMQSVMKFPIALAVLSEIDKGNLSFE
QKIEITPQDLLPKTWSPIKEEFPNGTTLTIEQILNYTVSESDNIGCDILLKLIGGTDSVQKFLNANHFTDISIKANEEQMHKDWNTQYQN
WATPTAMNKLLIDTYNNKNQLLSKKSYDFIWKIMRETTTGSNRLKGQLPKNTIVAHKTGTSGINNGIAAATNDVGVITLPNGQLIFISVF
VAESKETSEINEKIISDIAKITWNYYLNK

>gb|CU459141.1|-|3660737-3661636|VEB-1 [Acinetobacter baumannii AYE]
ATGAAAATCGTAAAAAGGATATTATTAGTATTGTTAAGTTTATTTTTTACAATTGTGTATTCAAATGCTCAAACTGACAACTTAACTTTG
AAAATTGAGAATGTTTTAAAGGCAAAAAATGCCAGAATAGGAGTAGCAATATTCAACAGCAATGAGAAGGATACTTTGAAGATTAATAAC
GACTTCCATTTCCCGATGCAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTTTGTCTGAGATAGATAAAGGGAATCTTTCTTTTGAA
CAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGAGTCCGATTAAAGAGGAATTCCCTAATGGAACAACTTTGACGATT
GAACAAATACTAAATTATACAGTATCAGAGAGCGACAATATTGGTTGTGATATTTTGCTAAAATTAATCGGAGGAACTGATTCTGTTCAA
AAATTCTTGAATGCTAATCATTTCACTGATATTTCAATCAAAGCAAACGAAGAACAAATGCACAAGGATTGGAATACCCAATATCAAAAT
TGGGCAACCCCAACAGCGATGAACAAACTGTTAATAGATACTTATAATAATAAGAACCAATTACTTTCTAAAAAAAGTTATGATTTTATT
TGGAAAATTATGAGAGAAACAACAACAGGAAGTAACCGATTAAAAGGACAATTACCAAAGAATACAATTGTTGCTCATAAAACAGGGACT
TCCGGAATAAATAATGGAATTGCAGCAGCCACTAATGATGTTGGGGTAATTACTTTACCGAATGGACAATTAATTTTTATAAGCGTATTT
GTTGCAGAGTCCAAAGAAACTTCGGAAATTAATGAAAAGATTATTTCAGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

VEB-1

Prevalence: protein homolog model (view sequences)

Graph