VEB-3

Accession ARO:3002372
CARD Short NameVEB-3
DefinitionVEB-3 is a beta-lactamase found in Enterobacter cloacae.
AMR Gene FamilyVEB beta-lactamase
Drug Classcephalosporin, monobactam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAeromonas caviaeg+wgs, Aeromonas hydrophilawgs, Aeromonas veroniip, Citrobacter freundiip+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheip, Escherichia coliwgs, Klebsiella michiganensisp, Klebsiella pneumoniaep+wgs, Pseudomonas aeruginosag
Resistomes with Sequence VariantsAeromonas caviaeg+wgs, Aeromonas hydrophilag+wgs, Aeromonas veroniip, Citrobacter freundiip+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheip, Escherichia coliwgs, Klebsiella michiganensisp, Klebsiella pneumoniaep+wgs, Pseudomonas aeruginosag
Classification14 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ VEB beta-lactamase [AMR Gene Family]
Publications

Jiang X, et al. 2005. J Clin Microbiol 43(2): 826-831. Outbreak of infection caused by Enterobacter cloacae producing the novel VEB-3 beta-lactamase in China. (PMID 15695687)

Resistomes

Prevalence of VEB-3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Aeromonas caviae2.27%0%0.54%0%
Aeromonas hydrophila3.08%0%0.81%0%
Aeromonas veronii0%1.54%0%0%
Citrobacter freundii0%0.62%0.19%0%
Enterobacter cloacae0%0%0.32%0%
Enterobacter hormaechei0%0.06%0%0%
Escherichia coli0%0%0.01%0%
Klebsiella michiganensis0%1.14%0%0%
Klebsiella pneumoniae0%0.02%0.02%0%
Pseudomonas aeruginosa0.31%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550


>gb|AAS48620.1|+|VEB-3 [Enterobacter cloacae]
MKIVKRILLVLLSLFFTVVYSNAQTDNLTLKIENVLKAKNARIGVAIFNSNEKDTFKINNDFHFPMQSVMKFPIALAVLSEIDKGNLSFE
QKIEITPQDLLPKTWSPIKEEFPNGTTLTIEQILNYTVSESDNIGCDILLKLIGGTDSVQKFLNANHFTDISIKANEEQMHKDWNTQYQN
WATPTAMNKLLIDTYNNKNQLLSKKSYDFIWKIMRETTTGSNRLKGQLPKNTIVAHKTGTSGINNGIAAATNDVGVITLPNGQLIFISVF
VAESKETSEINEKIISDIAKITWNYYLNK


>gb|AY536519.1|+|38-937|VEB-3 [Enterobacter cloacae]
ATGAAAATCGTAAAAAGGATATTATTAGTATTGTTAAGTTTATTTTTTACAGTTGTGTATTCAAATGCTCAAACTGACAACTTAACTTTG
AAAATTGAGAATGTTTTAAAGGCAAAAAATGCCAGAATAGGAGTAGCAATATTCAACAGCAATGAGAAGGATACTTTTAAGATTAATAAC
GACTTCCATTTCCCGATGCAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTTTGTCTGAGATAGATAAAGGGAATCTTTCTTTTGAA
CAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGAGTCCGATTAAAGAGGAATTCCCTAATGGAACAACTTTGACGATT
GAACAAATACTAAATTATACAGTATCAGAGAGCGACAATATTGGTTGTGATATTTTGCTAAAATTAATCGGAGGAACTGATTCTGTTCAA
AAATTCTTGAATGCTAATCATTTCACTGATATTTCAATCAAAGCAAACGAAGAACAAATGCACAAGGATTGGAATACCCAATATCAAAAT
TGGGCAACCCCAACAGCGATGAACAAACTGTTAATAGATACTTATAATAATAAGAACCAATTACTTTCTAAAAAAAGTTATGATTTTATT
TGGAAAATTATGAGAGAAACAACAACAGGAAGTAACCGATTAAAAGGACAATTACCAAAGAATACAATTGTTGCTCATAAAACAGGGACT
TCCGGAATAAATAATGGAATTGCAGCAGCCACTAATGATGTTGGGGTAATTACTTTACCGAATGGACAATTAATTTTTATAAGCGTATTT
GTTGCAGAGTCCAAAGAAACTTCGGAAATTAATGAAAAGATTATTTCAGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAA