AAC(3)-IXa

Accession ARO:3002543
Synonym(s)aacC9
CARD Short NameAAC(3)-IXa
DefinitionAAC(3)-IXa is a chromosomal-encoded aminoglycoside acetyltransferase in Micromonospora chalcea.
AMR Gene FamilyAAC(3)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ AAC(3)-IX
Publications

Salauze D, et al. 1991. Gene 101(1): 143-148. Characterisation of aminoglycoside acetyltransferase-encoding genes of neomycin-producing Micromonospora chalcea and Streptomyces fradiae. (PMID 2060791)

Resistomes

Prevalence of AAC(3)-IXa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAA25334.1|+|AAC(3)-IXa [Micromonospora chalcea]
MEEMSLLNHSGGPVTRSRIKHDLADLGLKDGDVVIFHTRMSAIGYVAGGTQTIIGALLDVVGARGTLMVPCGWNNAPPYDFLDWPRDWQD
ALRAEHPAYDPDLSEADYNNGRLPEALPRWPGAIRSRHPDASFAALGPAAAELMAEHPWDHPHGPDTPLARLIAHSGRVLLLGAPLDTMT
LLHHAEALADVRSKRFVTYEQPILVNGQRVWRQFRDIDSEEGAFDYSTVRRGVEPFEAIARDMLSAGIGRQGRVGAADSYLFDAGPVFNF
AINWIEAKLKR


>gb|M55427.1|+|274-1119|AAC(3)-IXa [Micromonospora chalcea]
ATGGAAGAGATGAGCTTACTCAATCACTCCGGCGGTCCCGTTACCCGAAGCCGGATCAAGCATGACCTTGCTGATCTCGGTCTCAAAGAC
GGAGACGTGGTGATTTTCCACACCCGCATGTCTGCCATCGGGTACGTGGCTGGCGGAACGCAGACAATCATCGGCGCACTCCTCGACGTT
GTGGGAGCCCGTGGAACCCTTATGGTGCCCTGTGGCTGGAACAACGCGCCTCCATATGACTTCCTCGATTGGCCACGGGACTGGCAGGAC
GCCCTGCGAGCAGAGCATCCCGCGTACGACCCGGACCTCAGTGAGGCGGACTACAATAATGGTCGTCTCCCAGAAGCGCTGCCGCGCTGG
CCTGGCGCGATCCGAAGTCGGCACCCCGACGCCAGTTTCGCAGCCCTGGGGCCGGCTGCAGCCGAACTGATGGCAGAGCATCCGTGGGAC
CATCCTCACGGACCCGACACCCCGCTAGCACGGCTGATCGCCCATAGCGGCCGAGTCTTGTTACTTGGCGCTCCATTGGACACCATGACG
CTGTTGCATCACGCTGAGGCGTTGGCCGACGTCCGCAGCAAACGGTTCGTGACCTACGAACAACCGATCCTCGTTAACGGCCAGCGGGTG
TGGCGACAATTCCGCGATATCGACTCTGAGGAAGGAGCGTTTGACTACTCGACGGTGCGCCGAGGGGTGGAGCCGTTCGAGGCCATTGCA
CGGGACATGCTCTCGGCAGGAATCGGTCGTCAGGGCAGGGTCGGCGCCGCGGATAGCTACCTGTTTGACGCCGGGCCTGTCTTCAATTTT
GCGATCAACTGGATCGAGGCCAAGCTGAAGAGATAG