aadA3

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002603
CARD Short NameaadA3
DefinitionaadA3 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids, transposons and integrons in E. coli.
AMR Gene FamilyANT(3'')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic spectinomycin [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ ANT(3'')-Ia
Resistomes with Sequence VariantsAchromobacter xylosoxidanswgs, Acinetobacter baumanniig+p+wgs, Acinetobacter indicusg+p, Acinetobacter juniiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Acinetobacter townerig+gi, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniip, Alcaligenes faecalisp, Burkholderia cepaciawgs, Citrobacter freundiiwgs, Citrobacter portucalensisp+wgs, Comamonas testosteronig, Delftia tsuruhatensisg, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap, Klebsiella pneumoniaep+wgs+gi, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensisg+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs+gi, Providencia rettgeriwgs, Pseudomonas aeruginosawgs+gi, Pseudomonas monteiliiwgs, Salmonella entericap+wgs+gi, Serratia marcescensp, Shigella flexnerip, Shigella sonneiwgs, Stenotrophomonas maltophiliawgs, Vibrio choleraewgs+gi
Publications

Parent R and Roy PH. 1992. J Bacteriol 174(9): 2891-2897. The chloramphenicol acetyltransferase gene of Tn2424: a new breed of cat. (PMID 1314803)

Resistomes

Prevalence of aadA3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Achromobacter xylosoxidans0%0%0.76%0%0%
Acinetobacter baumannii0.18%0.05%0.62%0%0%
Acinetobacter indicus4.76%5.66%0%0%0%
Acinetobacter junii0%0%1.49%0%0%
Acinetobacter nosocomialis0%0%0.57%0%0%
Acinetobacter pittii0%0%0.57%0%0%
Acinetobacter towneri12.5%0%0%100%0%
Aeromonas caviae6.82%2.6%6.99%0%0%
Aeromonas hydrophila0%1.3%0.81%0%0%
Aeromonas veronii0%1.54%0%0%0%
Alcaligenes faecalis0%20%0%0%0%
Burkholderia cepacia0%0%3.14%0%0%
Citrobacter freundii0%0%3.87%0%0%
Citrobacter portucalensis0%5.88%0.9%0%0%
Comamonas testosteroni20%0%0%0%0%
Delftia tsuruhatensis16.67%0%0%0%0%
Enterobacter asburiae0%0.28%7.51%0%0%
Enterobacter cloacae0%0.56%9.58%0%0%
Enterobacter hormaechei0%0.77%6.04%0%0%
Enterobacter kobei0%1.38%5.68%0%0%
Enterobacter roggenkampii0%0.48%12.59%0%0%
Escherichia coli0.02%0.18%0.94%0%1.46%
Escherichia fergusonii0%1.07%10.87%0%0%
Klebsiella michiganensis0%1.14%1.33%0%0%
Klebsiella oxytoca0%0.68%0%0%0%
Klebsiella pneumoniae0%0.46%1.23%0.95%0%
Klebsiella quasipneumoniae0%0.21%0.66%0%0%
Laribacter hongkongensis66.67%0%8.33%0%0%
Morganella morganii5.77%0%1.84%0%0%
Proteus mirabilis2.75%0%4.62%14.81%0%
Providencia rettgeri0%0%0.64%0%0%
Pseudomonas aeruginosa0%0%1.15%2.78%0%
Pseudomonas monteilii0%0%2.38%0%0%
Salmonella enterica0%0.11%2.55%4.3%0%
Serratia marcescens0%1.29%0%0%0%
Shigella flexneri0%0.8%0%0%0%
Shigella sonnei0%0%0.07%0%0%
Stenotrophomonas maltophilia0%0%0.74%0%0%
Vibrio cholerae0%0%1.41%4.76%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|AAC14728.1|+|aadA3 [Plasmid NR79]
MRVAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKPYSDIDLLVTVAVKLDETTRRALLNDLMEASAFPGESETLRAIEVTL
VVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPAMIDIDLAILLTKAREHSVALVGPAAEEFFDPVPEQDLFEALRETLKLWNSQPDWA
GDERNVVLTLSRIWYSAITGKIAPKDVAADWAIKRLPAQYQPVLLEAKQAYLGQKEDHLASRADHLEEFIHYVKGEITKVVGK


>gb|AF047479.2|+|1296-2087|aadA3 [Plasmid NR79]
ATGAGGGTAGCGGTGACCATCGAAATTTCGAACCAACTATCAGAGGTGCTAAGCGTCATTGAGCGCCATCTGGAATCAACGTTGCTGGCC
GTGCATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCATACAGCGATATTGATTTGTTGGTTACTGTGGCCGTAAAGCTTGATGAA
ACGACGCGGCGAGCATTGCTCAATGACCTTATGGAGGCTTCGGCTTTCCCTGGCGAGAGCGAGACGCTCCGCGCTATAGAAGTCACCCTT
GTCGTGCATGACGACATCATCCCGTGGCGTTATCCGGCTAAGCGCGAGCTGCAATTTGGAGAATGGCAGCGCAATGACATTCTTGCGGGT
ATCTTCGAGCCAGCCATGATCGACATTGATCTAGCTATCCTGCTTACAAAAGCAAGAGAACATAGCGTTGCCTTGGTAGGTCCGGCAGCG
GAGGAATTCTTTGACCCGGTTCCTGAACAGGATCTATTCGAGGCGCTGAGGGAAACCTTGAAGCTATGGAACTCGCAGCCCGACTGGGCC
GGCGATGAGCGAAATGTAGTGCTTACGTTGTCCCGCATTTGGTACAGCGCAATAACCGGCAAAATCGCGCCGAAGGATGTCGCTGCCGAC
TGGGCAATAAAACGCCTACCTGCCCAGTATCAGCCCGTCTTACTTGAAGCTAAGCAAGCTTATCTGGGACAAAAAGAAGATCACTTGGCC
TCACGCGCAGATCACTTGGAAGAATTTATTCACTACGTGAAAGGCGAGATCACCAAGGTAGTCGGCAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit