aadA5

Download Sequences

Accession	ARO:3002605
CARD Short Name	aadA5
Definition	aadA5 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids, transposons and integrons in E. coli, K. pneumoniae, Kluyvera georgiana, P. aeruginosa and E. cloacae.
AMR Gene Family	ANT(3'')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g+wgs, Acinetobacter pittii^wgs, Aeromonas hydrophila^p, Burkholderia cenocepacia^g, Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Corynebacterium diphtheriae^g+gi, Cronobacter dublinensis^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^g+p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^g+wgs+gi, Proteus mirabilis^p+wgs, Providencia alcalifaciens^g, Providencia rettgeri^p+wgs, Pseudomonas aeruginosa^g+wgs, Pseudomonas putida^wgs, Pseudomonas stutzeri^wgs, Salmonella enterica^g+p+wgs+gi, Shigella boydii^wgs, Shigella dysenteriae^wgs, Shigella flexneri^g+p+wgs, Shigella sonnei^p+wgs, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs, Yersinia enterocolitica^p+wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+p+wgs, Acinetobacter pittii^wgs, Aeromonas hydrophila^p, Burkholderia cenocepacia^g, Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Corynebacterium diphtheriae^g+gi, Cronobacter dublinensis^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^g+p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^g+wgs+gi, Proteus mirabilis^p+wgs, Providencia alcalifaciens^g, Providencia rettgeri^p+wgs, Pseudomonas aeruginosa^g+wgs, Pseudomonas putida^wgs, Pseudomonas stutzeri^wgs, Salmonella enterica^g+p+wgs+gi, Serratia marcescens^wgs, Shigella boydii^wgs, Shigella dysenteriae^wgs, Shigella flexneri^g+p+wgs, Shigella sonnei^p+wgs+gi, Vibrio cholerae^wgs, Vibrio parahaemolyticus^wgs, Yersinia enterocolitica^p+wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + nucleotidylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside nucleotidyltransferase (ANT) + aminoglycoside antibiotic [Drug Class] + ANT(3'') [AMR Gene Family] + ANT(3'')-I
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic spectinomycin [Antibiotic] + confers_resistance_to_antibiotic streptomycin [Antibiotic] + ANT(3'')-Ia
Publications	Sandvang D and Sandvang D. 1999. Antimicrob Agents Chemother 43(12): 3036-3038. Novel streptomycin and spectinomycin resistance gene as a gene cassette within a class 1 integron isolated from Escherichia coli. (PMID 10582907)

Resistomes

Prevalence of aadA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	1.24%	0%	0.58%	0%	0%
Acinetobacter baumannii	2.48%	0.05%	0.61%	0%	0%
Acinetobacter pittii	0%	0%	0.28%	0%	0%
Acinetobacter pittii	0%	0%	0.28%	0%	0%
Aeromonas hydrophila	0%	1.3%	0%	0%	0%
Aeromonas hydrophila	0%	1.3%	0%	0%	0%
Burkholderia cenocepacia	0.5%	0%	0%	0%	0%
Burkholderia cenocepacia	0.5%	0%	0%	0%	0%
Citrobacter freundii	0%	0%	5.03%	0%	0%
Citrobacter freundii	0%	0%	5.03%	0%	0%
Citrobacter portucalensis	0%	0%	3.6%	0%	0%
Citrobacter portucalensis	0%	0%	3.6%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Corynebacterium diphtheriae	1.85%	0%	0%	50%	0%
Corynebacterium diphtheriae	1.85%	0%	0%	50%	0%
Cronobacter dublinensis	0%	0%	2.56%	0%	0%
Cronobacter dublinensis	0%	0%	2.56%	0%	0%
Enterobacter cloacae	0%	0%	0.96%	0%	0%
Enterobacter cloacae	0%	0%	0.96%	0%	0%
Enterobacter hormaechei	0%	0.19%	1.99%	0%	0%
Enterobacter hormaechei	0%	0.19%	1.86%	0%	0%
Enterobacter kobei	4.55%	0%	1.75%	0%	0%
Enterobacter kobei	4.55%	0%	2.62%	0%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Escherichia coli	1.57%	2.43%	12.35%	0.26%	1.64%
Escherichia coli	1.52%	2.39%	12.02%	0.26%	1.64%
Escherichia fergusonii	0%	0.36%	9.78%	0%	0%
Escherichia fergusonii	0%	0.36%	9.78%	0%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%	0%
Klebsiella michiganensis	9.68%	0.57%	1.6%	0%	0%
Klebsiella michiganensis	9.68%	0.57%	1.6%	0%	0%
Klebsiella oxytoca	0%	0%	4.2%	0%	0%
Klebsiella oxytoca	0%	0%	4.2%	0%	0%
Klebsiella pneumoniae	0.06%	0.31%	1.04%	0%	0%
Klebsiella pneumoniae	0.06%	0.32%	1.16%	0%	0%
Klebsiella quasipneumoniae	0%	0%	1.05%	0%	0%
Klebsiella quasipneumoniae	0%	0%	1.05%	0%	0%
Morganella morganii	5.77%	0%	9.82%	7.69%	0%
Morganella morganii	5.77%	0%	9.82%	7.69%	0%
Proteus mirabilis	0%	1.25%	12.71%	0%	0%
Proteus mirabilis	0%	1.25%	12.71%	0%	0%
Providencia alcalifaciens	9.09%	0%	0%	0%	0%
Providencia alcalifaciens	9.09%	0%	0%	0%	0%
Providencia rettgeri	0%	2.7%	0.64%	0%	0%
Providencia rettgeri	0%	2.7%	0.64%	0%	0%
Pseudomonas aeruginosa	0.46%	0%	0.23%	0%	0%
Pseudomonas aeruginosa	0.46%	0%	0.23%	0%	0%
Pseudomonas putida	0%	0%	0.53%	0%	0%
Pseudomonas putida	0%	0%	0.53%	0%	0%
Pseudomonas stutzeri	0%	0%	4.58%	0%	0%
Pseudomonas stutzeri	0%	0%	4.58%	0%	0%
Salmonella enterica	0.5%	0.82%	0.95%	0.99%	0%
Salmonella enterica	0.5%	0.82%	0.97%	0.99%	0%
Serratia marcescens	0%	0%	0%	0%	0%
Serratia marcescens	0%	0%	1.31%	0%	0%
Shigella boydii	0%	0%	7.78%	0%	0%
Shigella boydii	0%	0%	7.78%	0%	0%
Shigella dysenteriae	0%	0%	3.33%	0%	0%
Shigella dysenteriae	0%	0%	3.33%	0%	0%
Shigella flexneri	7%	2.41%	8.23%	0%	0%
Shigella flexneri	7%	2.41%	8.23%	0%	0%
Shigella sonnei	0%	2.91%	1.31%	4.76%	0%
Shigella sonnei	0%	2.91%	1.31%	0%	0%
Vibrio cholerae	0%	0%	0.06%	0%	0%
Vibrio cholerae	0%	0%	0.06%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.1%	0%	0%
Yersinia enterocolitica	0%	2.22%	0.45%	0%	0%
Yersinia enterocolitica	0%	2.22%	0.45%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450

Protein
DNA

>gb|AAF17880.1|+|aadA5 [Escherichia coli]
MGEFFPAQVFKQLSHARAVIERHLAATLDTIHLFGSAIDGGLKPDSDIDLLVTVSAAPNDSLRQALMLDLLKVSSPPGDGGTWRPLELTV
VARSEVVPWRYPARRELQFGEWLRHDILSGTFEPAVLDHDLAILLTKARQHSLALLGPSAATFFEPVPKEHFSKALFDTIAQWNAESDWK
GDERNVVLALARIWYSASTGLIAPKDVAAAWVSERLPAEHRPLICKARAAYLGSEDDDLAMRVEETAAFVRYAKATIERILR

>gb|AF137361.1|+|64-852|aadA5 [Escherichia coli]
ATGGGTGAATTTTTCCCTGCACAAGTTTTCAAGCAGCTGTCCCACGCTCGCGCGGTGATCGAGCGCCATCTGGCTGCGACACTGGACACA
ATCCACCTGTTCGGATCTGCGATCGATGGAGGGCTGAAGCCGGACAGCGACATAGACTTGCTCGTGACCGTCAGCGCCGCACCTAACGAT
TCGCTCCGGCAGGCGCTAATGCTCGATTTGCTGAAAGTCTCATCACCGCCAGGCGATGGCGGAACATGGCGACCGCTGGAGCTAACTGTT
GTCGCTCGAAGCGAAGTAGTGCCTTGGCGCTATCCGGCGCGGCGTGAGCTTCAGTTCGGTGAGTGGCTCCGCCACGACATCCTTTCCGGA
ACGTTCGAGCCTGCCGTTCTGGATCACGATCTTGCGATTTTGCTGACCAAGGCGAGGCAACACAGCCTTGCGCTTCTAGGCCCATCCGCA
GCCACGTTTTTCGAGCCGGTGCCGAAGGAGCATTTCTCCAAGGCGCTTTTCGACACTATTGCCCAGTGGAATGCAGAGTCGGATTGGAAG
GGTGACGAGCGGAACGTCGTTCTTGCTCTTGCTCGCATTTGGTACAGCGCTTCAACTGGTCTCATTGCTCCTAAGGACGTTGCTGCCGCA
TGGGTATCGGAGCGTTTGCCTGCCGAGCATCGGCCCCTCATCTGCAAGGCACGCGCGGCGTACCTGGGTAGCGAGGACGACGACCTAGCA
ATGCGCGTCGAAGAGACGGCCGCGTTCGTTCGATATGCCAAAGCAACGATTGAGAGAATCTTGCGTTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

aadA5

Prevalence: protein homolog model (view sequences)

Graph