aadA5

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002605
CARD Short NameaadA5
DefinitionaadA5 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids, transposons and integrons in E. coli, K. pneumoniae, Kluyvera georgiana, P. aeruginosa and E. cloacae.
AMR Gene FamilyANT(3'')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs, Acinetobacter pittiiwgs, Aeromonas hydrophilap, Burkholderia cenocepaciag, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Corynebacterium diphtheriaeg+gi, Cronobacter dublinensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs+gi, Proteus mirabilisp+wgs, Providencia alcalifaciensg, Providencia rettgerip+wgs, Pseudomonas aeruginosag+wgs, Pseudomonas putidawgs, Pseudomonas stutzeriwgs, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs, Yersinia enterocoliticap+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter pittiiwgs, Aeromonas hydrophilap, Burkholderia cenocepaciag, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Corynebacterium diphtheriaeg+gi, Cronobacter dublinensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs+gi, Proteus mirabilisp+wgs, Providencia alcalifaciensg, Providencia rettgerip+wgs, Pseudomonas aeruginosag+wgs, Pseudomonas putidawgs, Pseudomonas stutzeriwgs, Salmonella entericag+p+wgs+gi, Serratia marcescenswgs, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs+gi, Vibrio choleraewgs, Vibrio parahaemolyticuswgs, Yersinia enterocoliticap+wgs
Classification12 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic spectinomycin [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ ANT(3'')-Ia
Publications

Sandvang D and Sandvang D. 1999. Antimicrob Agents Chemother 43(12): 3036-3038. Novel streptomycin and spectinomycin resistance gene as a gene cassette within a class 1 integron isolated from Escherichia coli. (PMID 10582907)

Resistomes

Prevalence of aadA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii2.48%0.05%0.61%0%0%
Acinetobacter pittii0%0%0.28%0%0%
Aeromonas hydrophila0%1.3%0%0%0%
Burkholderia cenocepacia0.5%0%0%0%0%
Citrobacter freundii0%0%5.03%0%0%
Citrobacter portucalensis0%0%3.6%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Corynebacterium diphtheriae1.85%0%0%50%0%
Cronobacter dublinensis0%0%2.56%0%0%
Enterobacter cloacae0%0%0.96%0%0%
Enterobacter hormaechei0%0.19%1.99%0%0%
Enterobacter kobei4.55%0%2.62%0%0%
Enterobacter roggenkampii0%0%0.72%0%0%
Escherichia coli1.57%2.43%12.35%0.26%1.64%
Escherichia fergusonii0%0.36%9.78%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis9.68%0.57%1.6%0%0%
Klebsiella oxytoca0%0%4.2%0%0%
Klebsiella pneumoniae0.06%0.32%1.16%0%0%
Klebsiella quasipneumoniae0%0%1.05%0%0%
Morganella morganii5.77%0%9.82%7.69%0%
Proteus mirabilis0%1.25%12.71%0%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia rettgeri0%2.7%0.64%0%0%
Pseudomonas aeruginosa0.46%0%0.23%0%0%
Pseudomonas putida0%0%0.53%0%0%
Pseudomonas stutzeri0%0%4.58%0%0%
Salmonella enterica0.5%0.82%0.97%0.99%0%
Serratia marcescens0%0%1.31%0%0%
Shigella boydii0%0%7.78%0%0%
Shigella dysenteriae0%0%3.33%0%0%
Shigella flexneri7%2.41%8.23%0%0%
Shigella sonnei0%2.91%1.31%4.76%0%
Vibrio cholerae0%0%0.06%0%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Yersinia enterocolitica0%2.22%0.45%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|AAF17880.1|+|aadA5 [Escherichia coli]
MGEFFPAQVFKQLSHARAVIERHLAATLDTIHLFGSAIDGGLKPDSDIDLLVTVSAAPNDSLRQALMLDLLKVSSPPGDGGTWRPLELTV
VARSEVVPWRYPARRELQFGEWLRHDILSGTFEPAVLDHDLAILLTKARQHSLALLGPSAATFFEPVPKEHFSKALFDTIAQWNAESDWK
GDERNVVLALARIWYSASTGLIAPKDVAAAWVSERLPAEHRPLICKARAAYLGSEDDDLAMRVEETAAFVRYAKATIERILR


>gb|AF137361.1|+|64-852|aadA5 [Escherichia coli]
ATGGGTGAATTTTTCCCTGCACAAGTTTTCAAGCAGCTGTCCCACGCTCGCGCGGTGATCGAGCGCCATCTGGCTGCGACACTGGACACA
ATCCACCTGTTCGGATCTGCGATCGATGGAGGGCTGAAGCCGGACAGCGACATAGACTTGCTCGTGACCGTCAGCGCCGCACCTAACGAT
TCGCTCCGGCAGGCGCTAATGCTCGATTTGCTGAAAGTCTCATCACCGCCAGGCGATGGCGGAACATGGCGACCGCTGGAGCTAACTGTT
GTCGCTCGAAGCGAAGTAGTGCCTTGGCGCTATCCGGCGCGGCGTGAGCTTCAGTTCGGTGAGTGGCTCCGCCACGACATCCTTTCCGGA
ACGTTCGAGCCTGCCGTTCTGGATCACGATCTTGCGATTTTGCTGACCAAGGCGAGGCAACACAGCCTTGCGCTTCTAGGCCCATCCGCA
GCCACGTTTTTCGAGCCGGTGCCGAAGGAGCATTTCTCCAAGGCGCTTTTCGACACTATTGCCCAGTGGAATGCAGAGTCGGATTGGAAG
GGTGACGAGCGGAACGTCGTTCTTGCTCTTGCTCGCATTTGGTACAGCGCTTCAACTGGTCTCATTGCTCCTAAGGACGTTGCTGCCGCA
TGGGTATCGGAGCGTTTGCCTGCCGAGCATCGGCCCCTCATCTGCAAGGCACGCGCGGCGTACCTGGGTAGCGAGGACGACGACCTAGCA
ATGCGCGTCGAAGAGACGGCCGCGTTCGTTCGATATGCCAAAGCAACGATTGAGAGAATCTTGCGTTGA

Curator Acknowledgements
Curator Description Most Recent Edit