aadA11

Download Sequences

Accession	ARO:3002611
CARD Short Name	aadA11
Definition	aadA11 is an integron-encoded aminoglycoside nucleotidyltransferase gene in E. coli and P. aeruginosa.
AMR Gene Family	ANT(3'')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g+wgs, Aeromonas caviae^wgs, Aeromonas veronii^g, Citrobacter freundii^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Serratia marcescens^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+wgs, Aeromonas caviae^wgs, Aeromonas veronii^g, Citrobacter freundii^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^p, Klebsiella michiganensis^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs+gi, Pseudomonas monteilii^wgs, Serratia marcescens^wgs, Stenotrophomonas maltophilia^g
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + nucleotidylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside nucleotidyltransferase (ANT) + aminoglycoside antibiotic [Drug Class] + ANT(3'') [AMR Gene Family] + ANT(3'')-I
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic spectinomycin [Antibiotic] + confers_resistance_to_antibiotic streptomycin [Antibiotic] + ANT(3'')-Ia
Publications	Llanes C, et al. 2006. Clin Microbiol Infect 12(3): 270-278. Genetic analysis of a multiresistant strain of Pseudomonas aeruginosa producing PER-1 beta-lactamase. (PMID 16451415)

Resistomes

Prevalence of aadA11 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0.18%	0%	0.03%	0%	0%
Acinetobacter baumannii	0.18%	0%	0.03%	0%	0%
Aeromonas caviae	0%	0%	0.54%	0%	0%
Aeromonas caviae	0%	0%	0.54%	0%	0%
Aeromonas veronii	1.82%	0%	0%	0%	0%
Aeromonas veronii	1.82%	0%	0%	0%	0%
Citrobacter freundii	0%	0%	0.19%	0%	0%
Citrobacter freundii	0%	0%	0.19%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter hormaechei	0%	0%	0.09%	0%	0%
Enterobacter hormaechei	0%	0%	0.13%	0%	0%
Enterobacter kobei	0%	0%	0%	0%	0%
Enterobacter kobei	0%	0.69%	0%	0%	0%
Klebsiella michiganensis	0%	0%	0%	0%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.36%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.81%	5.56%	0%
Pseudomonas monteilii	0%	0%	0%	0%	0%
Pseudomonas monteilii	0%	0%	4.76%	0%	0%
Serratia marcescens	0%	0%	0.39%	0%	0%
Serratia marcescens	0%	0%	0.66%	0%	0%
Stenotrophomonas maltophilia	1.12%	0%	0%	0%	0%
Stenotrophomonas maltophilia	0%	0%	0%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450

Protein
DNA

>gb|AAV32840.1|+|aadA11 [Pseudomonas aeruginosa]
MSNAVPAEISVQLSLALNAIERHLESTLLAVHLYGSALDGGLKPYSDIDLLVTVAAQLDETVRQALVVDLLEISASPGQSEALRALEVTI
VVHGDVVPWRYPARRELQFGEWQRKDILAGIFEPATTDVDLAILLTKVRQHSLALAGSAAEDFFNPVPEGDLFKALSDTLKLWNSQPDWE
GDERNVVLTLSRIWYSAATGKIAPKDIVANWAIERLPDQHKPVLLEARQAYLGQGEDCLASRADQLAAFVHFVKHEATKLLGAMPVMSNN
SFKPNPLRGSA

>gb|AY758206.1|+|2744-3589|aadA11 [Pseudomonas aeruginosa]
ATGAGTAACGCAGTACCCGCCGAGATTTCGGTACAGCTATCACTGGCTCTCAACGCCATCGAGCGTCATCTGGAATCAACGTTGCTGGCC
GTGCATTTGTACGGCTCTGCACTGGACGGTGGCCTGAAGCCATACAGTGATATTGATTTGCTGGTTACTGTGGCTGCACAGCTCGATGAG
ACTGTCCGACAAGCCCTGGTCGTAGATCTCTTGGAAATTTCTGCCTCCCCTGGCCAAAGTGAGGCTCTCCGCGCCTTGGAAGTTACCATC
GTCGTGCATGGTGATGTTGTCCCTTGGCGTTATCCGGCCAGACGGGAACTGCAATTCGGGGAGTGGCAGCGTAAGGACATTCTTGCGGGC
ATCTTCGAGCCCGCCACAACCGATGTTGATCTGGCTATTCTGCTAACTAAAGTAAGGCAGCATAGCCTTGCATTGGCAGGTTCGGCCGCA
GAGGATTTCTTTAACCCAGTTCCGGAAGGCGATCTATTCAAGGCATTGAGCGACACTCTGAAACTATGGAATTCGCAGCCGGATTGGGAA
GGCGATGAGCGGAATGTAGTGCTTACCTTGTCTCGCATTTGGTACAGCGCAGCAACCGGCAAGATCGCACCGAAGGATATCGTTGCCAAC
TGGGCAATTGAGCGTCTGCCAGATCAACATAAGCCCGTACTGCTTGAAGCCCGGCAGGCTTATCTTGGACAAGGAGAAGATTGCTTGGCC
TCACGCGCGGATCAGTTGGCGGCGTTCGTTCACTTCGTGAAACATGAAGCCACTAAATTGCTTGGTGCCATGCCAGTGATGTCTAACAAT
TCATTCAAGCCGAACCCGCTTCGCGGGTCGGCTTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

aadA11

Prevalence: protein homolog model (view sequences)

Graph