aadA13

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002613
CARD Short NameaadA13
DefinitionaadA13 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in Pseudomonas rettgeri, P. aeruginosa, Y. enterocolitica and E. coli.
AMR Gene FamilyANT(3'')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic spectinomycin [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ ANT(3'')-Ia
Resistomes with Perfect MatchesEscherichia coliwgs, Morganella morganiiwgs, Pseudomonas aeruginosawgs, Pseudomonas monteiliiwgs, Pseudomonas putidawgs, Serratia marcescenswgs, Stutzerimonas stutzerig
Resistomes with Sequence VariantsEctopseudomonas mendocinawgs, Enterobacter hormaecheiwgs, Escherichia albertiiwgs, Escherichia colig+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs, Pseudomonas aeruginosawgs, Pseudomonas monteiliiwgs, Pseudomonas putidawgs, Salmonella entericawgs, Serratia marcescenswgs, Stutzerimonas stutzerig, Vibrio vulnificuswgs
Publications

Revilla C, et al. 2008. Antimicrob Agents Chemother 52(4): 1472-1480. Different pathways to acquiring resistance genes illustrated by the recent evolution of IncW plasmids. (PMID 18268088)

Resistomes

Prevalence of aadA13 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Ectopseudomonas mendocina0%0%14.29%0%0%
Enterobacter hormaechei0%0%0.04%0%0%
Escherichia albertii0%0%1.29%0%0%
Escherichia coli0.02%0%0.07%0%0.35%
Klebsiella quasipneumoniae0%0%0.13%0%0%
Morganella morganii3.85%0%1.23%0%0%
Pseudomonas aeruginosa0%0%0.74%0%0%
Pseudomonas monteilii0%0%2.38%0%0%
Pseudomonas putida0%0%0.53%0%0%
Salmonella enterica0%0%0.01%0%0%
Serratia marcescens0%0%1.05%0%0%
Stutzerimonas stutzeri3.57%0%0%0%0%
Vibrio vulnificus0%0%0.41%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|ABW91178.1|+|aadA13 [Pseudomonas aeruginosa]
MRDSVTAEISTQLSKVLSVIEHHLEPTLLAVHLYGSAVDGGLKPYSDIDLLVTVTARLDDTTRRALFNDLLEVSAFPGESEILRAIEVTI
VVHEDIMPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLIKALNETLKLWNSQPDWA
GDERNVVLTLSRIWYSAATGKIAPKDVAANWAMEHLPAQHQSVLLEARQAYLGQEEDRSVLRADKLEEFIHFMKSEITKVLGNDV


>gb|EU746499.1|+|640-1437|aadA13 [Pseudomonas aeruginosa]
ATGAGGGACTCAGTGACCGCCGAAATTTCGACGCAACTATCCAAGGTGCTTAGTGTTATCGAGCACCATCTGGAACCGACGTTGCTTGCC
GTACATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCATACAGTGATATTGATTTGCTGGTTACTGTGACCGCAAGGCTTGATGAC
ACAACGCGGCGAGCTTTGTTCAACGATCTTTTGGAGGTTTCGGCTTTCCCAGGCGAGAGTGAGATTCTCCGCGCTATAGAAGTCACCATT
GTCGTGCACGAAGACATTATGCCGTGGCGTTATCCAGCCAAGCGCGAACTGCAATTTGGAGAATGGCAGCGCAATGACATTCTTGCGGGT
ATCTTCGAGCCAGCCACGATCGACATCGATCTGGCTATCTTGCTAACGAAAGCGAGAGAACATAGCGTGGCTTTGGTAGGTCCGGCGGCG
GAGGAACTCTTTGATCCAGTTCCTGAACAAGATCTAATCAAGGCGCTGAATGAAACCTTGAAGCTATGGAACTCGCAGCCCGACTGGGCC
GGCGATGAGCGAAATGTAGTGCTTACGTTGTCCCGCATTTGGTACAGCGCAGCAACTGGTAAAATCGCGCCGAAGGATGTCGCTGCCAAC
TGGGCAATGGAACATCTACCTGCCCAGCATCAGTCTGTCTTGCTTGAAGCTAGACAGGCTTATCTTGGGCAAGAGGAAGATCGCTCGGTC
TTGCGCGCAGATAAGTTGGAAGAATTTATTCACTTCATGAAAAGCGAGATCACCAAGGTGCTCGGCAATGATGTCTAA

Curator Acknowledgements
Curator Description Most Recent Edit