aadA16

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002616
CARD Short NameaadA16
DefinitionaadA16 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in E. coli, V. cholerae and K. pneumoniae.
AMR Gene FamilyANT(3'')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic spectinomycin [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ ANT(3'')-Ia
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs+gi, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+wgs, Alcaligenes faecaliswgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Comamonas testosteroniwgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogenesg+p+wgs, Klebsiella huaxiensisg+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensisg+wgs+gi, Leclercia adecarboxylatap+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs, Providencia alcalifaciensg, Providencia rettgerig+wgs, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella flexnerip+wgs, Vibrio alginolyticusg, Vibrio choleraep+wgs, Vibrio harveyiwgs, Vibrio parahaemolyticusp
Publications

Wei Q, et al. 2009. J Antimicrob Chemother 63(2): 405-406. dfrA27, a new integron-associated trimethoprim resistance gene from Escherichia coli. (PMID 19008256)

Resistomes

Prevalence of aadA16 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0.04%0.63%0%
Aeromonas caviae11.36%2.6%12.37%0%0%
Aeromonas hydrophila1.54%1.3%2.42%0%0%
Aeromonas veronii3.64%0%2.81%0%0%
Alcaligenes faecalis0%0%2.94%0%0%
Citrobacter freundii0%0.92%6%0%0%
Citrobacter koseri0%0%1.8%0%0%
Citrobacter portucalensis0%1.47%1.8%0%0%
Citrobacter werkmanii0%10%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Comamonas testosteroni0%0%7.14%0%0%
Enterobacter asburiae0%0%1.98%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Enterobacter hormaechei0%0.45%2.93%0%0%
Enterobacter kobei0%0%3.06%0%0%
Enterobacter roggenkampii0%0.48%2.52%0%0%
Escherichia coli0.05%0.18%0.61%0%0.09%
Escherichia fergusonii0%0%1.09%0%0%
Klebsiella aerogenes2%1.09%1.13%0%0%
Klebsiella huaxiensis100%0%0%50%0%
Klebsiella michiganensis0%2.29%3.46%0%0%
Klebsiella oxytoca0%1.37%0.84%0%0%
Klebsiella pneumoniae0.06%1.51%5.26%0.95%0%
Klebsiella quasipneumoniae0%2.97%8.03%0%0%
Laribacter hongkongensis66.67%0%4.17%50%0%
Leclercia adecarboxylata0%4.76%4.65%0%0%
Morganella morganii3.85%0%1.84%0%0%
Proteus mirabilis2.75%0%0.66%0%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia rettgeri5.88%0%0.64%0%0%
Pseudomonas aeruginosa0%0%0.01%0%0%
Raoultella planticola0%6.98%2.56%0%0%
Salmonella enterica0.19%0.33%0.35%0%0%
Serratia marcescens0%0%1.05%0%0%
Shigella flexneri0%1.2%0.31%0%0%
Vibrio alginolyticus1.23%0%0%0%0%
Vibrio cholerae0%5.26%0.32%0%0%
Vibrio harveyi0%0%4%0%0%
Vibrio parahaemolyticus0%0.62%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|ACF17980.1|+|aadA16 [Escherichia coli]
MSNAVPAEISVQLSQALNVIERHLGSTLLAVHLYGSALDGGLKPCSDIDLLVTVTAQLDETVRQALFVDFLEVSASPGQSEALRALEVTI
VVYGDVAPWRYLARRELQFGEWQRKDILAGIFEPATTDVDLAILLTKARQHSLALAGSAAEDFFNSVPESDLFKALADTLKLWNSQPDWA
GDERNVVLTLSRIWYSAATGKIAPKDVAANWVMERLPVQHQPVLLEAQQAYLGQGMDCLASRADQLTAFIYFVKHEAASLLGSTPMMSNS
SFKPTPLRGAA


>gb|EU675686.2|+|3197-4042|aadA16 [Escherichia coli]
ATGAGCAACGCAGTGCCCGCCGAGATTTCGGTACAGCTATCACAGGCACTCAACGTCATCGAGCGTCATCTGGGATCGACGTTGCTGGCC
GTGCATTTGTACGGCTCTGCACTCGACGGTGGCCTGAAGCCATGCAGTGATATTGATTTGCTGGTTACTGTGACTGCACAGCTCGATGAG
ACTGTGCGGCAGGCTCTGTTCGTAGATTTCCTGGAAGTTTCCGCTTCTCCCGGCCAAAGTGAAGCTCTCCGTGCCTTGGAAGTTACCATC
GTCGTGTACGGCGATGTTGCTCCTTGGCGTTATCTAGCCAGACGGGAACTGCAATTCGGGGAGTGGCAGCGCAAGGACATTCTTGCGGGC
ATCTTCGAGCCCGCGACAACCGATGTTGATCTGGCTATTCTGCTAACTAAAGCAAGGCAACACAGCCTTGCCTTGGCAGGTTCGGCCGCG
GAAGATTTCTTCAACTCAGTCCCGGAAAGCGATCTATTCAAAGCACTGGCCGACACCTTGAAACTATGGAACTCACAACCGGATTGGGCA
GGCGACGAGCGGAATGTAGTGCTTACTTTGTCTCGCATTTGGTACAGCGCAGCAACCGGCAAGATCGCGCCGAAGGATGTAGCTGCCAAC
TGGGTAATGGAACGCCTGCCCGTCCAACATCAGCCCGTGCTGCTTGAAGCCCAGCAGGCTTACCTTGGACAAGGGATGGATTGCTTGGCC
TCACGCGCTGATCAGTTGACTGCGTTCATTTACTTTGTGAAGCACGAAGCCGCCAGTCTGCTCGGCTCCACGCCAATGATGTCTAACAGT
TCATTCAAGCCGACGCCGCTTCGCGGCGCAGCTTAA

Curator Acknowledgements
Curator Description Most Recent Edit