aadA22

Download Sequences

Accession	ARO:3002619
CARD Short Name	aadA22
Definition	aadA22 is an aminoglycoside nucleotidyltransferase gene encoded by plasmids and integrons in S. enterica and E. coli.
AMR Gene Family	ANT(3'')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter werkmanii^p, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter roggenkampii^p, Escherichia albertii^p, Escherichia coli^p+wgs, Escherichia fergusonii^p+wgs, Klebsiella oxytoca^p, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Salmonella enterica^g+p+wgs, Shigella flexneri^p, Shigella sonnei^wgs
Resistomes with Sequence Variants	Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^p, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter roggenkampii^p, Escherichia albertii^p, Escherichia coli^p+wgs, Escherichia fergusonii^p+wgs, Klebsiella oxytoca^p, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Pseudomonas aeruginosa^p+wgs, Salmonella enterica^g+p+wgs, Shigella flexneri^p, Shigella sonnei^wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + nucleotidylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside nucleotidyltransferase (ANT) + aminoglycoside antibiotic [Drug Class] + ANT(3'') [AMR Gene Family] + ANT(3'')-I
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic spectinomycin [Antibiotic] + confers_resistance_to_antibiotic streptomycin [Antibiotic] + ANT(3'')-Ia
Publications	Herrero A, et al. 2008. Int J Med Microbiol 298(3-4): 253-261. Salmonella enterica serotype Typhimurium carrying hybrid virulence-resistance plasmids (pUO-StVR): a new multidrug-resistant group endemic in Spain. (PMID 17597002)

Resistomes

Prevalence of aadA22 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter freundii	0%	0%	0%	0%	0%
Citrobacter freundii	0%	0%	0.19%	0%	0%
Citrobacter portucalensis	0%	0%	0%	0%	0%
Citrobacter portucalensis	0%	0%	2.7%	0%	0%
Citrobacter werkmanii	0%	10%	0%	0%	0%
Citrobacter werkmanii	0%	10%	0%	0%	0%
Enterobacter asburiae	0%	0%	0.79%	0%	0%
Enterobacter asburiae	0%	0%	0.79%	0%	0%
Enterobacter cloacae	0%	1.12%	0.32%	0%	0%
Enterobacter cloacae	0%	1.12%	0.64%	0%	0%
Enterobacter hormaechei	0%	0.13%	0.22%	0%	0%
Enterobacter hormaechei	0%	0.13%	0.17%	0%	0%
Enterobacter roggenkampii	0%	0.48%	0%	0%	0%
Enterobacter roggenkampii	0%	0.48%	0%	0%	0%
Escherichia albertii	0%	0.56%	0%	0%	0%
Escherichia albertii	0%	0.56%	0%	0%	0%
Escherichia coli	0%	0.49%	0.87%	0%	0.31%
Escherichia coli	0%	0.47%	0.71%	0%	0.13%
Escherichia fergusonii	0%	0.71%	3.26%	0%	0%
Escherichia fergusonii	0%	0.71%	3.26%	0%	0%
Klebsiella oxytoca	0%	0.68%	0%	0%	0%
Klebsiella oxytoca	0%	0.68%	0%	0%	0%
Klebsiella pneumoniae	0%	0.09%	0.08%	0%	0%
Klebsiella pneumoniae	0%	0.09%	0.11%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.13%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.26%	0%	0%
Pseudomonas aeruginosa	0%	0%	0%	0%	0%
Pseudomonas aeruginosa	0%	0.88%	0.04%	0%	0%
Salmonella enterica	0.13%	1.53%	0.44%	0%	0%
Salmonella enterica	0.13%	1.81%	0.5%	0%	0%
Shigella flexneri	0%	1.2%	0%	0%	0%
Shigella flexneri	0%	1.2%	0%	0%	0%
Shigella sonnei	0%	0%	0.29%	0%	0%
Shigella sonnei	0%	0%	0.29%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450

Protein
DNA

>gb|CAK12750.1|+|aadA22 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRVAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKPYSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTI
VVHDDIIPWRYPAKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA
GDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVIGK

>gb|AM261837.1|+|74-865|aadA22 [Salmonella enterica subsp. enterica serovar Typhimurium]
ATGAGGGTAGCGGTGACCATCGAAATTTCGAACCAACTATCAGAGGTGCTAAGCGTCATTGAGCGCCATCTGGAATCAACGTTGCTGGCC
GTGCATTTGTACGGCTCCGCAGTGGATGGCGGCCTGAAGCCATACAGCGATATTGATTTGCTGGTTACGGTGACCGTAAGGCTTGATGAA
ACAACGCGGCGAGCTTTGATCAACGACCTTTTGGAAACTTCGGCTTCCCCTGGAGAGAGCGAGATTCTCCGCGCTGTAGAAGTCACCATT
GTTGTGCACGACGACATCATTCCGTGGCGTTATCCAGCTAAGCGCGAACTGCAATTTGGAGAATGGCAGCGCAATGACATTCTTGCAGGT
ATCTTCGAGCCAGCCACGATCGACATTGATCTGGCTATCTTGCTGACAAAAGCAAGAGAACATAGCGTTGCCTTGGTAGGTCCAGCGGCG
GAGGAACTCTTTGATCCGGTTCCTGAACAGGATCTATTTGAGGCGCTAAATGAAACCTTAACGCTATGGAACTCGCCGCCCGACTGGGCT
GGCGATGAGCGAAATGTAGTGCTTACGTTGTCCCGCATTTGGTACAGCGCAGTAACCGGCAAAATCGCGCCGAAGGATGTCGCTGCCGAC
TGGGCAATGGAGCGCCTGCCGGCCCAGTATCAGCCCGTCATACTTGAAGCTAGACAGGCTTATCTTGGACAAGAAGAAGATCGCTTGGCC
TCGCGCGCAGATCAGTTGGAAGAATTTGTCCACTACGTGAAAGGCGAGATCACCAAGGTAATCGGCAAATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

aadA22

Prevalence: protein homolog model (view sequences)

Graph