lnuC

Accession ARO:3002837
Synonym(s)linC
CARD Short NamelnuC
DefinitionlnuC is a transposon-mediated nucleotidyltransferase found in Streptococcus agalactiae.
AMR Gene Familylincosamide nucleotidyltransferase (LNU)
Drug Classlincosamide antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsAnaerostipes hadruswgs, Brachyspira pilosicolig+wgs, Campylobacter coliwgs, Campylobacter jejunig+wgs, Clostridium perfringenswgs, Enterocloster clostridioformiswgs, Enterococcus faecalisp+wgs, Escherichia coliwgs, Eubacterium maltosivoransg, Faecalibacterium prausnitziiwgs, Glaesserella parasuisg+wgs, Gordonibacter urolithinfacienswgs, Lactobacillus crispatusg+wgs, Lactobacillus johnsoniig+wgs, Ligilactobacillus animalisg+wgs, Megasphaera stantoniig+wgs, Mobiluncus mulieriswgs, Streptococcus agalactiaeg+wgs, Streptococcus dysgalactiaewgs, Streptococcus gallolyticuswgs, Streptococcus lutetiensisg+wgs, Streptococcus mitisg+wgs, Streptococcus pasteurianusg+wgs, Streptococcus suisg+wgs, Streptococcus uberiswgs
Classification8 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ lincosamide nucleotidyltransferase (LNU) [AMR Gene Family]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
Publications

Achard A, et al. 2005. Antimicrob Agents Chemother 49(7): 2716-2719. New lnu(C) gene conferring resistance to lincomycin by nucleotidylation in Streptococcus agalactiae UCN36. (PMID 15980341)

Resistomes

Prevalence of lnuC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Anaerostipes hadrus0%0%3.64%0%
Brachyspira pilosicoli25%0%4.76%0%
Campylobacter coli0%0%1.25%0%
Campylobacter jejuni1.2%0%0.35%0%
Clostridium perfringens0%0%0.6%0%
Enterocloster clostridioformis0%0%2.86%0%
Enterococcus faecalis0%0.33%0.05%0%
Escherichia coli0%0%0.04%0%
Eubacterium maltosivorans100%0%0%0%
Faecalibacterium prausnitzii0%0%1.1%0%
Glaesserella parasuis4.35%0%2.78%0%
Gordonibacter urolithinfaciens0%0%9.09%0%
Lactobacillus crispatus11.11%0%1.88%0%
Lactobacillus johnsonii5.56%0%2.38%0%
Ligilactobacillus animalis100%0%33.33%0%
Megasphaera stantonii100%0%50%0%
Mobiluncus mulieris0%0%5%0%
Streptococcus agalactiae1.04%0%1.52%0%
Streptococcus dysgalactiae0%0%2.06%0%
Streptococcus gallolyticus0%0%15%0%
Streptococcus lutetiensis14.29%0%17.5%0%
Streptococcus mitis11.11%0%0.65%0%
Streptococcus pasteurianus50%0%21.43%0%
Streptococcus suis2.27%0%0.56%0%
Streptococcus uberis0%0%6.67%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAY32951.1|+|lnuC [Streptococcus agalactiae]
MVNITDVNQIFQFAIDAEIKVFLDGGWGVDALLGYQSRAHNDIDIFVEKNDYQNFIEIMKANGFYEIKMEYTTLNHTVWEDLKNRIIDLH
CFEYTDEGEILYDGDCFPVETLSGKGRIEEIEVSCIEPYSQVMFHLGYEFDENDAHDVKLLCETLHIEIPNEYR


>gb|AY928180.1|+|1-495|lnuC [Streptococcus agalactiae]
ATGGTCAATATAACAGATGTAAACCAGATTTTCCAATTTGCAATAGATGCGGAGATTAAAGTCTTTCTTGATGGTGGCTGGGGTGTAGAT
GCTCTTCTTGGATATCAGTCAAGAGCCCATAATGATATTGACATTTTTGTAGAAAAGAACGATTATCAGAACTTTATAGAAATAATGAAA
GCTAATGGCTTTTATGAGATTAAGATGGAATATACAACATTGAACCATACTGTATGGGAAGATTTGAAAAACAGAATTATTGATTTGCAT
TGTTTTGAATATACGGACGAAGGTGAAATTCTTTATGATGGGGATTGTTTTCCGGTAGAAACTCTTTCGGGTAAAGGAAGAATTGAGGAA
ATAGAGGTTTCCTGTATTGAACCATATAGTCAAGTAATGTTCCATCTGGGATACGAGTTTGATGAAAATGATGCACATGATGTGAAGTTA
TTGTGTGAGACACTTCATATCGAAATTCCAAATGAGTATAGATAA