vanH gene in vanO cluster

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002948
Synonym(s)vanH-O vanHO
CARD Short NamevanH_in_vanO_cl
DefinitionAlso known as vanHO, is a vanH variant in the vanO gene cluster.
AMR Gene Familyglycopeptide resistance gene cluster, vanH
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic
Resistance Mechanismantibiotic target alteration
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ vanH [AMR Gene Family]
+ part_of glycopeptide resistance gene cluster VanO
Resistomes with Sequence VariantsBurkholderia ambifariag+wgs, Burkholderia cenocepaciag+wgs, Burkholderia cepaciag+wgs, Burkholderia contaminansg+wgs, Burkholderia dolosag+wgs, Burkholderia latag+wgs, Burkholderia malleig+wgs, Burkholderia multivoransg+wgs, Burkholderia oklahomensisg+wgs, Burkholderia pseudomalleig+wgs, Burkholderia thailandensisg+wgs, Burkholderia vietnamiensisg+p+wgs, Clostridium botulinumg+wgs, Clostridium butyricumg+wgs, Clostridium septicumg+wgs, Clostridium tetanig+wgs, Collinsella aerofacienswgs, Dysosmobacter welbionisg+wgs, Eubacterium limosumg+wgs, Eubacterium maltosivoransg+wgs, Faecalibacterium prausnitziig+wgs, Nocardia terpenicag, Roseburia hominisg+wgs, Stenotrophomonas maltophiliag+wgs, Stutzerimonas stutzerig+wgs, Thomasclavelia ramosag+wgs
Publications

Gudeta DD, et al. 2014. Antimicrob Agents Chemother 58(3): 1768-1770. vanO, a new glycopeptide resistance operon in environmental Rhodococcus equi isolates. (PMID 24342631)

Resistomes

Prevalence of vanH gene in vanO cluster among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Burkholderia ambifaria16.28%0%5.19%0%0%
Burkholderia cenocepacia3.02%0%9.21%0%0%
Burkholderia cepacia29.09%0%90.13%0%0%
Burkholderia contaminans2.04%0%15%0%0%
Burkholderia dolosa33.33%0%95%0%0%
Burkholderia lata11.11%0%68.75%0%0%
Burkholderia mallei50.85%0%92.86%0%0%
Burkholderia multivorans0.64%0%4.55%0%0%
Burkholderia oklahomensis50%0%100%0%0%
Burkholderia pseudomallei49.83%0%98.8%0%0%
Burkholderia thailandensis50%0%100%0%0%
Burkholderia vietnamiensis34.38%9.09%99.14%0%0%
Clostridium botulinum4.48%0%7.34%0%0%
Clostridium butyricum66.67%0%98.04%0%0%
Clostridium septicum100%0%100%0%0%
Clostridium tetani50%0%92.11%0%0%
Collinsella aerofaciens0%0%1.49%0%0%
Dysosmobacter welbionis100%0%66.67%0%0%
Escherichia coli0%0%0%0%0%
Eubacterium limosum100%0%100%0%0%
Eubacterium maltosivorans100%0%100%0%0%
Faecalibacterium prausnitzii6.67%0%18.45%0%0%
Nocardia terpenica50%0%0%0%0%
Roseburia hominis100%0%77.78%0%0%
Stenotrophomonas maltophilia2.25%0%1.48%0%0%
Stutzerimonas stutzeri10.71%0%12.98%0%0%
Thomasclavelia ramosa80%0%95.35%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|AHA41499.1|+|vanH gene in vanO cluster [Rhodococcus hoagii]
MSYRDLGLIDSEVIAERRVRALDDSSPSAVPTTGVRVFGCGHDEAVLFREMGTRLGITPSITEEAISETNAELARGNRCISVSHKTQIDN
STLLALSRVGVEYISTRSVGYNHIDVEFAASIGISVGNVDYSPDSVGDYTLMLMLMTVRHAKSIVRRADTHDYRLNDTRGRELRDLTVGV
IGTGRIGTAVIDRLQGFGCRVLAHDSGPHASADYVPLDELLRQSDIVTLHTPLTADTHHLLDRQRIDQMKHGAYIVNTGRGPLLDTEALL
SALESGRLGGAALDVVEGEEGIFYADCRNRLIENKALVRLQRLPNVLISPHSAYYTDHALNDTVENSLVNCLNFESGRTA


>gb|KF478993.1|+|491-1543|vanH gene in vanO cluster [Rhodococcus hoagii]
ATGTCCTACAGAGACCTGGGTTTGATCGACAGCGAAGTGATCGCGGAGCGACGCGTCCGAGCGCTCGACGATTCGTCACCCTCGGCCGTC
CCGACCACTGGGGTCAGAGTTTTCGGATGCGGTCACGACGAAGCCGTTTTGTTCCGCGAGATGGGAACCCGCCTCGGGATAACGCCAAGC
ATCACCGAGGAAGCGATCAGTGAAACCAACGCTGAACTGGCGCGTGGCAACCGATGCATCAGCGTGAGCCACAAGACGCAGATCGACAAT
TCCACGCTGCTGGCGCTGAGCCGAGTCGGAGTGGAGTACATCTCCACCAGAAGCGTCGGGTACAACCACATCGACGTGGAATTCGCGGCG
AGCATCGGCATCTCGGTCGGCAACGTCGACTACTCGCCCGACAGCGTGGGCGACTACACACTGATGTTGATGCTGATGACCGTACGCCAC
GCGAAATCAATTGTCCGCCGCGCCGATACGCATGATTACCGGCTGAATGACACGCGCGGCAGGGAGCTGCGCGACTTGACCGTCGGGGTG
ATCGGAACAGGGCGCATCGGCACAGCAGTCATCGACCGGCTGCAGGGATTTGGCTGCCGCGTGCTGGCACATGACAGCGGGCCTCACGCC
TCCGCCGACTACGTTCCGCTCGATGAACTGCTGCGGCAGAGCGACATTGTCACGCTCCACACTCCACTCACCGCGGACACACACCATCTC
CTCGATCGCCAACGCATCGACCAGATGAAGCACGGCGCGTACATCGTCAACACGGGTCGCGGACCGCTGCTCGATACCGAGGCCCTCCTC
TCCGCATTGGAGAGCGGCCGGTTGGGCGGCGCGGCGCTCGATGTCGTCGAAGGAGAGGAAGGGATCTTCTACGCCGACTGCAGGAACAGG
CTCATCGAGAACAAGGCCCTGGTGCGGCTACAGCGCCTGCCGAATGTGCTGATCAGTCCGCACTCCGCCTACTACACAGACCACGCCCTG
AACGACACCGTCGAAAACAGCCTCGTCAACTGCCTGAACTTTGAAAGTGGGAGAACAGCATGA

Curator Acknowledgements
Curator Description Most Recent Edit