vanZ gene in vanF cluster

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002963
Synonym(s)vanZ-F vanZF
CARD Short NamevanZ_in_vanF_cl
DefinitionAlso known as vanZF, is a vanZ variant found in the vanF gene cluster.
AMR Gene Familyglycopeptide resistance gene cluster, vanZ
Drug Classglycopeptide antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Sequence VariantsBrevibacillus laterosporuswgs
Classification12 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ vanZ [AMR Gene Family]
+ part_of glycopeptide resistance gene cluster VanF
Publications

Fraimow H, et al. 2005. Antimicrob Agents Chemother 49(7): 2625-2633. Putative VanRS-like two-component regulatory system associated with the inducible glycopeptide resistance cluster of Paenibacillus popilliae. (PMID 15980329)

Resistomes

Prevalence of vanZ gene in vanF cluster among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Brevibacillus laterosporus0%0%20.59%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|AAF36806.1|+|vanZ gene in vanF cluster [Paenibacillus popilliae ATCC 14706]
MLTPLTVLYTYFCTIIFCIVFQIGFFFKALKNISIRHFLWVYVFLFYLALVYMMTGIGNVWVVGRYETLIRVSEINLLPFSSEGVTTYIL
NIILFMPLGFLLPTIWPQFRTIKNTACTGFFFSLAIELTQLLNHRITDIDDLLMNTLGAIIGYLLYRAFKMIYTRDEKKLDNKSSLVIKY
EAIFYIVCSFIGMILLYYPFLLRKII


>gb|AF155139.1|+|4339-4959|vanZ gene in vanF cluster [Paenibacillus popilliae ATCC 14706]
ATGCTTACACCACTTACAGTTTTATATACTTATTTTTGTACTATTATTTTTTGTATTGTGTTTCAAATTGGATTTTTTTTTAAAGCGCTA
AAAAATATATCTATTAGGCATTTTCTATGGGTGTATGTTTTTCTGTTCTACCTTGCGCTAGTGTATATGATGACGGGGATAGGGAATGTA
TGGGTAGTAGGAAGATATGAAACATTGATTCGTGTAAGTGAAATCAACTTACTTCCATTTTCTTCTGAAGGTGTTACTACGTATATTTTG
AACATTATTCTGTTTATGCCGTTAGGTTTTTTATTGCCAACTATTTGGCCGCAGTTTAGAACAATTAAAAATACTGCATGTACTGGATTC
TTTTTTTCATTGGCTATTGAGCTAACTCAATTGCTAAATCATAGAATTACAGATATTGATGATTTACTTATGAACACCCTGGGGGCGATT
ATTGGGTATTTATTATATAGAGCTTTTAAAATGATATATACAAGAGATGAAAAAAAGCTTGATAATAAATCTTCTCTAGTAATAAAATAC
GAGGCTATTTTTTATATAGTTTGCTCGTTTATAGGTATGATATTACTTTATTATCCATTTTTATTACGAAAAATTATTTGA

Curator Acknowledgements
Curator Description Most Recent Edit