vanW gene in vanG cluster

Download Sequences

Accession	ARO:3002965
Synonym(s)	vanW-G vanWG
CARD Short Name	vanW_in_vanG_cl
Definition	Also known as vanWG, is a vanW variant found in the vanG gene cluster.
AMR Gene Family	glycopeptide resistance gene cluster, vanW
Drug Class	glycopeptide antibiotic
Resistance Mechanism	antibiotic target alteration
Resistomes with Perfect Matches	Streptococcus agalactiae^g, Streptococcus anginosus^g
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Acinetobacter calcoaceticus^wgs, Acinetobacter johnsonii^g+wgs, Acinetobacter junii^wgs, Acinetobacter lwoffii^wgs, Bacillus anthracis^wgs, Bacillus cereus^g+wgs, Bacillus thuringiensis^g+wgs, Brevibacillus brevis^g+wgs, Brevibacillus laterosporus^g+wgs, Chryseobacterium nakagawai^g+wgs, Elizabethkingia anophelis^g+wgs, Elizabethkingia miricola^g+wgs, Enterococcus faecalis^g+wgs, Klebsiella pneumoniae^wgs, Kocuria palustris^g+wgs, Leminorella grimontii^wgs, Paenibacillus mucilaginosus^g+wgs, Porphyromonas gingivalis^g+wgs, Proteus columbae^g+wgs, Proteus penneri^g+wgs, Proteus vulgaris^g+wgs, Providencia heimbachae^g+wgs, Providencia rettgeri^g+wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^g+p+wgs, Pseudomonas brassicacearum^wgs, Pseudomonas chlororaphis^wgs, Pseudomonas fluorescens^g+wgs, Pseudomonas koreensis^g+wgs, Pseudomonas putida^g+wgs, Pseudomonas syringae^g+wgs, Ruthenibacterium lactatiformans^g+wgs, Staphylococcus arlettae^wgs, Staphylococcus aureus^g+wgs, Staphylococcus epidermidis^wgs, Staphylococcus equorum^wgs, Staphylococcus haemolyticus^wgs, Staphylococcus saprophyticus^wgs, Staphylococcus simulans^g+wgs, Staphylococcus warneri^g+p+wgs, Streptococcus agalactiae^g+wgs, Streptococcus anginosus^g, Streptococcus gwangjuense^g, Streptococcus lutetiensis^g+wgs, Streptococcus mitis^g+wgs, Streptococcus pseudopneumoniae^wgs, Streptococcus suis^wgs, Treponema denticola^g, Xanthomonas campestris^g+wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic target alteration [Resistance Mechanism] + restructuring of bacterial cell wall conferring antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + glycopeptide antibiotic [Drug Class] + protein(s) conferring antibiotic resistance via molecular bypass + antibiotic resistance gene cluster, cassette, or operon + gene(s) or protein(s) associated with a glycopeptide resistance cluster + glycopeptide resistance gene cluster [AMR Gene Family] + vancomycin [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + vanW [AMR Gene Family] + part_of glycopeptide resistance gene cluster VanG
Publications	Boyd DA, et al. 2006. Antimicrob Agents Chemother 50(6): 2217-2221. VanG-type vancomycin-resistant Enterococcus faecalis strains isolated in Canada. (PMID 16723588)

Resistomes

Prevalence of vanW gene in vanG cluster among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0%	0%	0%	0%	0%
Acinetobacter baumannii	0%	0%	0.04%	0%	0%
Acinetobacter calcoaceticus	0%	0%	4.35%	0%	0%
Acinetobacter calcoaceticus	0%	0%	0%	0%	0%
Acinetobacter johnsonii	89.47%	0%	94.55%	0%	0%
Acinetobacter johnsonii	0%	0%	0%	0%	0%
Acinetobacter junii	0%	0%	7.46%	0%	0%
Acinetobacter junii	0%	0%	0%	0%	0%
Acinetobacter lwoffii	0%	0%	2.63%	0%	0%
Acinetobacter lwoffii	0%	0%	0%	0%	0%
Bacillus anthracis	0%	0%	0.44%	0%	0%
Bacillus anthracis	0%	0%	0%	0%	0%
Bacillus cereus	0%	0%	0%	0%	0%
Bacillus cereus	34.41%	0%	67.7%	0%	0%
Bacillus thuringiensis	76.25%	0%	90.58%	0%	0%
Bacillus thuringiensis	0%	0%	0%	0%	0%
Brevibacillus brevis	0%	0%	0%	0%	0%
Brevibacillus brevis	14.29%	0%	30%	0%	0%
Brevibacillus laterosporus	0%	0%	0%	0%	0%
Brevibacillus laterosporus	33.33%	0%	20.59%	0%	0%
Chryseobacterium nakagawai	100%	0%	100%	0%	0%
Chryseobacterium nakagawai	0%	0%	0%	0%	0%
Elizabethkingia anophelis	100%	0%	100%	0%	0%
Elizabethkingia anophelis	0%	0%	0%	0%	0%
Elizabethkingia miricola	0%	0%	0%	0%	0%
Elizabethkingia miricola	100%	0%	100%	0%	0%
Enterococcus faecalis	0%	0%	0%	0%	0%
Enterococcus faecalis	0.45%	0%	0.12%	0%	0%
Klebsiella pneumoniae	0%	0%	0%	0%	0%
Klebsiella pneumoniae	0%	0%	0.01%	0%	0%
Kocuria palustris	100%	0%	88.89%	0%	0%
Kocuria palustris	0%	0%	0%	0%	0%
Leminorella grimontii	0%	0%	85.71%	0%	0%
Leminorella grimontii	0%	0%	0%	0%	0%
Paenibacillus mucilaginosus	100%	0%	100%	0%	0%
Paenibacillus mucilaginosus	0%	0%	0%	0%	0%
Porphyromonas gingivalis	0%	0%	0%	0%	0%
Porphyromonas gingivalis	100%	0%	91.38%	0%	0%
Proteus columbae	100%	0%	100%	0%	0%
Proteus columbae	0%	0%	0%	0%	0%
Proteus penneri	100%	0%	100%	0%	0%
Proteus penneri	0%	0%	0%	0%	0%
Proteus vulgaris	0%	0%	0%	0%	0%
Proteus vulgaris	100%	0%	100%	0%	0%
Providencia heimbachae	0%	0%	0%	0%	0%
Providencia heimbachae	100%	0%	100%	0%	0%
Providencia rettgeri	50%	0%	60.51%	0%	0%
Providencia rettgeri	0%	0%	0%	0%	0%
Providencia stuartii	0%	0%	9.09%	0%	0%
Providencia stuartii	0%	0%	0%	0%	0%
Pseudomonas aeruginosa	99.54%	0.29%	99.7%	0%	0%
Pseudomonas aeruginosa	0%	0%	0%	0%	0%
Pseudomonas brassicacearum	0%	0%	0%	0%	0%
Pseudomonas brassicacearum	0%	0%	4%	0%	0%
Pseudomonas chlororaphis	0%	0%	9.68%	0%	0%
Pseudomonas chlororaphis	0%	0%	0%	0%	0%
Pseudomonas fluorescens	25%	0%	19.57%	0%	0%
Pseudomonas fluorescens	0%	0%	0%	0%	0%
Pseudomonas koreensis	0%	0%	0%	0%	0%
Pseudomonas koreensis	75%	0%	65.22%	0%	0%
Pseudomonas putida	1.41%	0%	1.07%	0%	0%
Pseudomonas putida	0%	0%	0%	0%	0%
Pseudomonas syringae	2.08%	0%	0.17%	0%	0%
Pseudomonas syringae	0%	0%	0%	0%	0%
Ruthenibacterium lactatiformans	0%	0%	0%	0%	0%
Ruthenibacterium lactatiformans	100%	0%	100%	0%	0%
Staphylococcus arlettae	0%	0%	22.5%	0%	0%
Staphylococcus arlettae	0%	0%	0%	0%	0%
Staphylococcus aureus	0%	0%	0%	0%	0%
Staphylococcus aureus	0.09%	0%	0.12%	0%	0%
Staphylococcus epidermidis	0%	0%	0%	0%	0%
Staphylococcus epidermidis	0%	0%	2.76%	0%	0%
Staphylococcus equorum	0%	0%	0%	0%	0%
Staphylococcus equorum	0%	0%	16.07%	0%	0%
Staphylococcus haemolyticus	0%	0%	0%	0%	0%
Staphylococcus haemolyticus	0%	0%	4.4%	0%	0%
Staphylococcus saprophyticus	0%	0%	0%	0%	0%
Staphylococcus saprophyticus	0%	0%	0.7%	0%	0%
Staphylococcus simulans	50%	0%	69.49%	0%	0%
Staphylococcus simulans	0%	0%	0%	0%	0%
Staphylococcus warneri	0%	0%	0%	0%	0%
Staphylococcus warneri	50%	2.5%	65.57%	0%	0%
Streptococcus agalactiae	0.93%	0%	0%	0%	0%
Streptococcus agalactiae	1.87%	0%	0.06%	0%	0%
Streptococcus anginosus	5.88%	0%	0%	0%	0%
Streptococcus anginosus	5.88%	0%	0%	0%	0%
Streptococcus gwangjuense	100%	0%	0%	0%	0%
Streptococcus gwangjuense	0%	0%	0%	0%	0%
Streptococcus lutetiensis	0%	0%	0%	0%	0%
Streptococcus lutetiensis	100%	0%	61.22%	0%	0%
Streptococcus mitis	0%	0%	0%	0%	0%
Streptococcus mitis	11.11%	0%	11.11%	0%	0%
Streptococcus pseudopneumoniae	0%	0%	7.63%	0%	0%
Streptococcus pseudopneumoniae	0%	0%	0%	0%	0%
Streptococcus suis	0%	0%	0.26%	0%	0%
Streptococcus suis	0%	0%	0%	0%	0%
Treponema denticola	6.67%	0%	0%	0%	0%
Treponema denticola	0%	0%	0%	0%	0%
Xanthomonas campestris	0%	0%	0%	0%	0%
Xanthomonas campestris	1.06%	0%	0.79%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 50

Protein
DNA

>gb|ABA71730.1|+|vanW gene in vanG cluster [Enterococcus faecalis]
MIEVYKLTQRKRLTQLFPFLLPLRKWQRKKYFYFKMKFDGNRYAKKTSEKLLPNTVFETSSLMLNENSGFDMKYQINKVHNLKLAAKTIN
KVIIEPKETFSFWQLVRWADRHEKYKDGLNLVNGKIVGSYGGGLCQLSNMLFWLFLHTPLVIVERHGHAVESFPSTTEDLPCGTDATINE
GWLDLKLRNDTDNTFQIEISFDDNFMYGRILSQSSVNIEYTVFNSSVSYFKREEKVYQIASVCRTEKDKMTGSQTEKELYVNQCEIAYKL
PDDVKIEERGV

>gb|DQ212986.1|+|5138-5983|vanW gene in vanG cluster [Enterococcus faecalis]
GTGATTGAGGTGTATAAATTAACACAAAGAAAAAGACTAACGCAGTTGTTTCCTTTTTTGCTACCTCTCCGCAAATGGCAAAGAAAAAAA
TATTTTTATTTCAAAATGAAATTTGACGGCAATAGATACGCAAAAAAGACATCTGAGAAATTGTTACCAAACACAGTATTTGAAACATCA
TCACTTATGCTAAATGAAAATAGTGGATTTGATATGAAGTACCAAATCAATAAGGTACACAACCTAAAACTTGCCGCAAAAACAATCAAT
AAAGTGATTATTGAGCCGAAAGAAACATTTTCATTTTGGCAGCTTGTACGATGGGCAGACCGTCACGAGAAATATAAGGACGGATTAAAT
CTTGTTAATGGAAAGATTGTAGGCTCTTATGGCGGAGGTTTGTGTCAATTGAGTAATATGCTATTTTGGCTTTTTTTACACACGCCGCTT
GTTATTGTCGAGCGACACGGACACGCAGTTGAGTCTTTCCCATCAACAACCGAAGATTTGCCCTGCGGTACTGATGCTACGATTAACGAA
GGTTGGTTAGACCTAAAACTCCGTAACGACACGGACAATACTTTCCAGATTGAGATTAGTTTTGATGACAACTTTATGTATGGTCGAATT
TTGTCGCAAAGCTCCGTAAATATTGAATATACGGTTTTTAATTCGTCTGTTTCCTATTTCAAGCGAGAGGAAAAAGTATATCAAATAGCT
TCTGTTTGTCGTACAGAAAAAGACAAAATGACTGGTAGTCAGACGGAAAAAGAATTGTATGTCAACCAATGTGAAATAGCCTATAAGCTA
CCCGATGATGTAAAAATTGAAGAAAGAGGTGTGTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

vanW gene in vanG cluster

Prevalence: protein homolog model (view sequences)

Graph