vanW gene in vanG cluster

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002965
Synonym(s)vanW-G vanWG
CARD Short NamevanW_in_vanG_cl
DefinitionAlso known as vanWG, is a vanW variant found in the vanG gene cluster.
AMR Gene Familyglycopeptide resistance gene cluster, vanW
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic
Resistance Mechanismantibiotic target alteration
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ vanW [AMR Gene Family]
+ part_of glycopeptide resistance gene cluster VanG
Resistomes with Perfect MatchesStreptococcus agalactiaeg, Streptococcus anginosusg
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Acinetobacter calcoaceticuswgs, Acinetobacter johnsoniig+wgs, Acinetobacter juniiwgs, Acinetobacter lwoffiiwgs, Bacillus anthraciswgs, Bacillus cereusg+wgs, Bacillus thuringiensisg+wgs, Brevibacillus brevisg+wgs, Brevibacillus laterosporusg+wgs, Chryseobacterium nakagawaig+wgs, Elizabethkingia anophelisg+wgs, Elizabethkingia miricolag+wgs, Enterococcus faecalisg+wgs, Klebsiella pneumoniaewgs, Kocuria palustrisg+wgs, Leminorella grimontiiwgs, Paenibacillus mucilaginosusg+wgs, Porphyromonas gingivalisg+wgs, Proteus columbaeg+wgs, Proteus pennerig+wgs, Proteus vulgarisg+wgs, Providencia heimbachaeg+wgs, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas brassicacearumwgs, Pseudomonas chlororaphiswgs, Pseudomonas fluorescensg+wgs, Pseudomonas koreensisg+wgs, Pseudomonas putidag+wgs, Pseudomonas syringaeg+wgs, Ruthenibacterium lactatiformansg+wgs, Staphylococcus arlettaewgs, Staphylococcus aureusg+wgs, Staphylococcus epidermidiswgs, Staphylococcus equorumwgs, Staphylococcus haemolyticuswgs, Staphylococcus saprophyticuswgs, Staphylococcus simulansg+wgs, Staphylococcus warnerig+p+wgs, Streptococcus agalactiaeg+wgs, Streptococcus anginosusg, Streptococcus gwangjuensisg, Streptococcus lutetiensisg+wgs, Streptococcus mitisg+wgs, Streptococcus pseudopneumoniaewgs, Streptococcus suiswgs, Treponema denticolag, Xanthomonas campestrisg+wgs
Publications

Boyd DA, et al. 2006. Antimicrob Agents Chemother 50(6): 2217-2221. VanG-type vancomycin-resistant Enterococcus faecalis strains isolated in Canada. (PMID 16723588)

Resistomes

Prevalence of vanW gene in vanG cluster among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.04%0%0%
Acinetobacter calcoaceticus0%0%4.35%0%0%
Acinetobacter johnsonii89.47%0%94.55%0%0%
Acinetobacter junii0%0%7.46%0%0%
Acinetobacter lwoffii0%0%2.63%0%0%
Bacillus anthracis0%0%0.44%0%0%
Bacillus cereus34.41%0%67.7%0%0%
Bacillus thuringiensis76.25%0%90.58%0%0%
Brevibacillus brevis14.29%0%30%0%0%
Brevibacillus laterosporus33.33%0%20.59%0%0%
Chryseobacterium nakagawai100%0%100%0%0%
Elizabethkingia anophelis100%0%100%0%0%
Elizabethkingia miricola100%0%100%0%0%
Enterococcus faecalis0.45%0%0.12%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Kocuria palustris100%0%88.89%0%0%
Leminorella grimontii0%0%85.71%0%0%
Paenibacillus mucilaginosus100%0%100%0%0%
Porphyromonas gingivalis100%0%91.38%0%0%
Proteus columbae100%0%100%0%0%
Proteus penneri100%0%100%0%0%
Proteus vulgaris100%0%100%0%0%
Providencia heimbachae100%0%100%0%0%
Providencia rettgeri50%0%60.51%0%0%
Providencia stuartii0%0%9.09%0%0%
Pseudomonas aeruginosa99.54%0.29%99.7%0%0%
Pseudomonas brassicacearum0%0%4%0%0%
Pseudomonas chlororaphis0%0%9.68%0%0%
Pseudomonas fluorescens25%0%19.57%0%0%
Pseudomonas koreensis75%0%65.22%0%0%
Pseudomonas putida1.41%0%1.07%0%0%
Pseudomonas syringae2.08%0%0.17%0%0%
Ruthenibacterium lactatiformans100%0%100%0%0%
Staphylococcus arlettae0%0%22.5%0%0%
Staphylococcus aureus0.09%0%0.12%0%0%
Staphylococcus epidermidis0%0%2.76%0%0%
Staphylococcus equorum0%0%16.07%0%0%
Staphylococcus haemolyticus0%0%4.4%0%0%
Staphylococcus saprophyticus0%0%0.7%0%0%
Staphylococcus simulans50%0%69.49%0%0%
Staphylococcus warneri50%2.5%65.57%0%0%
Streptococcus agalactiae1.87%0%0.06%0%0%
Streptococcus anginosus5.88%0%0%0%0%
Streptococcus gwangjuensis100%0%0%0%0%
Streptococcus lutetiensis100%0%61.22%0%0%
Streptococcus mitis11.11%0%11.11%0%0%
Streptococcus pseudopneumoniae0%0%7.63%0%0%
Streptococcus suis0%0%0.26%0%0%
Treponema denticola6.67%0%0%0%0%
Xanthomonas campestris1.06%0%0.79%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 50


>gb|ABA71730.1|+|vanW gene in vanG cluster [Enterococcus faecalis]
MIEVYKLTQRKRLTQLFPFLLPLRKWQRKKYFYFKMKFDGNRYAKKTSEKLLPNTVFETSSLMLNENSGFDMKYQINKVHNLKLAAKTIN
KVIIEPKETFSFWQLVRWADRHEKYKDGLNLVNGKIVGSYGGGLCQLSNMLFWLFLHTPLVIVERHGHAVESFPSTTEDLPCGTDATINE
GWLDLKLRNDTDNTFQIEISFDDNFMYGRILSQSSVNIEYTVFNSSVSYFKREEKVYQIASVCRTEKDKMTGSQTEKELYVNQCEIAYKL
PDDVKIEERGV


>gb|DQ212986.1|+|5138-5983|vanW gene in vanG cluster [Enterococcus faecalis]
GTGATTGAGGTGTATAAATTAACACAAAGAAAAAGACTAACGCAGTTGTTTCCTTTTTTGCTACCTCTCCGCAAATGGCAAAGAAAAAAA
TATTTTTATTTCAAAATGAAATTTGACGGCAATAGATACGCAAAAAAGACATCTGAGAAATTGTTACCAAACACAGTATTTGAAACATCA
TCACTTATGCTAAATGAAAATAGTGGATTTGATATGAAGTACCAAATCAATAAGGTACACAACCTAAAACTTGCCGCAAAAACAATCAAT
AAAGTGATTATTGAGCCGAAAGAAACATTTTCATTTTGGCAGCTTGTACGATGGGCAGACCGTCACGAGAAATATAAGGACGGATTAAAT
CTTGTTAATGGAAAGATTGTAGGCTCTTATGGCGGAGGTTTGTGTCAATTGAGTAATATGCTATTTTGGCTTTTTTTACACACGCCGCTT
GTTATTGTCGAGCGACACGGACACGCAGTTGAGTCTTTCCCATCAACAACCGAAGATTTGCCCTGCGGTACTGATGCTACGATTAACGAA
GGTTGGTTAGACCTAAAACTCCGTAACGACACGGACAATACTTTCCAGATTGAGATTAGTTTTGATGACAACTTTATGTATGGTCGAATT
TTGTCGCAAAGCTCCGTAAATATTGAATATACGGTTTTTAATTCGTCTGTTTCCTATTTCAAGCGAGAGGAAAAAGTATATCAAATAGCT
TCTGTTTGTCGTACAGAAAAAGACAAAATGACTGGTAGTCAGACGGAAAAAGAATTGTATGTCAACCAATGTGAAATAGCCTATAAGCTA
CCCGATGATGTAAAAATTGAAGAAAGAGGTGTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit