bacA

Accession ARO:3002986
CARD Short NamebacA
DefinitionThe bacA gene product (BacA) recycles undecaprenyl pyrophosphate during cell wall biosynthesis which confers resistance to bacitracin.
AMR Gene Familyundecaprenyl pyrophosphate related proteins
Drug Classpeptide antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Perfect MatchesEscherichia colig+p+wgs, Shigella boydiig+wgs, Shigella dysenteriaewgs, Shigella flexnerig+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsCitrobacter amalonaticusg+wgs, Citrobacter werkmaniiwgs, Enterobacter asburiaeg+wgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiig+wgs, Enterococcus faeciumwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella pneumoniaeg+wgs, Mycobacterium aviumwgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs, Staphylococcus aureuswgs
Classification10 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic bacitracin A [Antibiotic]
+ confers_resistance_to_antibiotic bacitracin B [Antibiotic]
+ confers_resistance_to_antibiotic bacitracin F [Antibiotic]
+ undecaprenyl pyrophosphate related proteins [AMR Gene Family]
Publications

Shaaly A, et al. 2013. J Antimicrob Chemother 68(7): 1583-1593. Undecaprenyl pyrophosphate phosphatase confers low-level resistance to bacitracin in Enterococcus faecalis. (PMID 23460607)

Resistomes

Prevalence of bacA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Citrobacter amalonaticus100%0%85.42%0%
Citrobacter werkmanii0%0%4.76%0%
Enterobacter asburiae4.76%0%0.69%0%
Enterobacter cloacae56.82%0%53.64%0%
Enterobacter hormaechei93.45%0%78.88%0%
Enterobacter kobei0%0%0.82%0%
Enterobacter roggenkampii23.08%0%11.52%0%
Enterococcus faecium0%0%0.13%0%
Escherichia albertii100%0%97.7%0%
Escherichia coli61.58%0.03%74.72%0%
Escherichia fergusonii100%0%44.62%0%
Escherichia marmotae100%0%69.05%0%
Klebsiella pneumoniae0.09%0%0.11%0%
Mycobacterium avium0%0%0.48%0%
Pseudomonas aeruginosa0%0%0.02%0%
Salmonella enterica94.68%0.07%89.3%0%
Shigella boydii100%0%95.7%0%
Shigella dysenteriae90.91%0%100%0%
Shigella flexneri100%0%83.5%0%
Shigella sonnei100%0%95.71%0%
Staphylococcus aureus0%0%0.01%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AAC76093.1|-|bacA [Escherichia coli str. K-12 substr. MG1655]
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAVVVMFWRRLFGLIGIHFGRPLQHEGESKGRL
TLIHILLGMIPAVVLGLLFHDTIKSLFNPINVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS
GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTSGDIPMFAVGFITAFVVALIAIKTFLQLIKRISFIPFAIYRFIVAAAVYV
VFF


>gb|U00096.3|-|3203310-3204131|bacA [Escherichia coli str. K-12 substr. MG1655]
ATGAGCGATATGCACTCGCTGCTGATAGCGGCAATATTGGGTGTGGTCGAAGGATTGACAGAATTTCTGCCGGTATCCAGCACGGGCCAT
ATGATTATTGTCGGTCACTTGTTGGGGTTTGAGGGCGACACGGCGAAAACCTTTGAAGTTGTGATCCAGTTAGGATCAATTCTGGCGGTA
GTAGTGATGTTCTGGCGGCGTCTGTTTGGCCTGATTGGCATCCACTTTGGCCGCCCGTTGCAGCACGAAGGTGAAAGCAAAGGTCGTTTA
ACGCTGATCCACATTTTGCTGGGGATGATTCCGGCGGTGGTATTGGGGCTGTTGTTCCACGACACGATTAAGTCATTGTTTAACCCGATA
AATGTGATGTATGCGCTGGTCGTTGGCGGTTTGTTGCTGATTGCCGCCGAATGCCTGAAGCCGAAAGAGCCGCGTGCGCCGGGTCTTGAT
GATATGACCTATCGTCAGGCATTTATGATTGGCTGTTTCCAGTGTCTGGCGCTGTGGCCGGGTTTCTCCCGTTCCGGGGCGACCATTTCA
GGTGGGATGCTGATGGGGGTGAGCCGTTACGCTGCTTCCGAGTTTTCGTTCCTGCTGGCGGTGCCGATGATGATGGGCGCAACGGCGCTC
GATCTCTACAAAAGCTGGGGCTTCCTGACAAGCGGCGATATCCCGATGTTTGCCGTTGGGTTTATCACCGCTTTTGTGGTGGCGCTGATA
GCGATTAAAACCTTCCTGCAATTGATTAAGCGCATTTCGTTTATCCCGTTCGCCATTTATCGCTTTATTGTGGCGGCTGCGGTGTATGTC
GTGTTCTTTTAA