bacA

Download Sequences

Ontology	CARD's Antibiotic Resistance Ontology
Accession	ARO:3002986
CARD Short Name	bacA
Definition	The bacA gene product (BacA) recycles undecaprenyl pyrophosphate during cell wall biosynthesis which confers resistance to bacitracin.
AMR Gene Family	undecaprenyl pyrophosphate related proteins
Drug Class	peptide antibiotic
Resistance Mechanism	antibiotic target alteration
Resistomes with Perfect Matches	Escherichia coli^g+p+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^wgs, Shigella flexneri^g+wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^g+wgs, Enterobacter cloacae^wgs, Escherichia albertii^g+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^g+wgs, Escherichia marmotae^g+wgs, Salmonella bongori^g+wgs, Salmonella enterica^g+p+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Classification	10 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic molecule + antibiotic target alteration [Resistance Mechanism] + antibiotic mixture + restructuring of bacterial cell wall conferring antibiotic resistance + peptide antibiotic [Drug Class] + determinant of antibiotic resistance + protein(s) conferring antibiotic resistance via molecular bypass + bacitracin [Antibiotic]
Parent Term(s)	4 ontology terms \| Show + confers_resistance_to_antibiotic bacitracin A [Antibiotic] + confers_resistance_to_antibiotic bacitracin B [Antibiotic] + confers_resistance_to_antibiotic bacitracin F [Antibiotic] + undecaprenyl pyrophosphate related proteins [AMR Gene Family]
Publications	Shaaly A, et al. 2013. J Antimicrob Chemother 68(7): 1583-1593. Undecaprenyl pyrophosphate phosphatase confers low-level resistance to bacitracin in Enterococcus faecalis. (PMID 23460607)

Resistomes

Prevalence of bacA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	100%	0%	98.18%	0%	0%
Citrobacter amalonaticus	0%	0%	0%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%	0%
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia albertii	100%	0%	99.35%	0%	0%
Escherichia coli	28.25%	0.01%	30.37%	0%	29.88%
Escherichia coli	67.89%	0.02%	99.34%	0%	99.87%
Escherichia fergusonii	100%	0%	100%	0%	0%
Escherichia fergusonii	0%	0%	0%	0%	0%
Escherichia marmotae	100%	0%	97.92%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Salmonella bongori	0%	0%	0%	0%	0%
Salmonella bongori	83.33%	0%	100%	0%	0%
Salmonella enterica	95.71%	0.05%	99.63%	0%	0%
Salmonella enterica	0%	0%	0%	0%	0%
Shigella boydii	100%	0%	100%	0%	0%
Shigella boydii	13.33%	0%	12.22%	0%	0%
Shigella dysenteriae	0%	0%	6.67%	0%	0%
Shigella dysenteriae	92.86%	0%	100%	0%	0%
Shigella flexneri	99%	0%	99.69%	0%	0%
Shigella flexneri	23%	0%	0.47%	0%	0%
Shigella sonnei	0%	0%	1.97%	0%	0%
Shigella sonnei	100%	0%	99.63%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AAC76093.1|-|bacA [Escherichia coli str. K-12 substr. MG1655]
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAVVVMFWRRLFGLIGIHFGRPLQHEGESKGRL
TLIHILLGMIPAVVLGLLFHDTIKSLFNPINVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS
GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTSGDIPMFAVGFITAFVVALIAIKTFLQLIKRISFIPFAIYRFIVAAAVYV
VFF

>gb|U00096.3|-|3203310-3204131|bacA [Escherichia coli str. K-12 substr. MG1655]
ATGAGCGATATGCACTCGCTGCTGATAGCGGCAATATTGGGTGTGGTCGAAGGATTGACAGAATTTCTGCCGGTATCCAGCACGGGCCAT
ATGATTATTGTCGGTCACTTGTTGGGGTTTGAGGGCGACACGGCGAAAACCTTTGAAGTTGTGATCCAGTTAGGATCAATTCTGGCGGTA
GTAGTGATGTTCTGGCGGCGTCTGTTTGGCCTGATTGGCATCCACTTTGGCCGCCCGTTGCAGCACGAAGGTGAAAGCAAAGGTCGTTTA
ACGCTGATCCACATTTTGCTGGGGATGATTCCGGCGGTGGTATTGGGGCTGTTGTTCCACGACACGATTAAGTCATTGTTTAACCCGATA
AATGTGATGTATGCGCTGGTCGTTGGCGGTTTGTTGCTGATTGCCGCCGAATGCCTGAAGCCGAAAGAGCCGCGTGCGCCGGGTCTTGAT
GATATGACCTATCGTCAGGCATTTATGATTGGCTGTTTCCAGTGTCTGGCGCTGTGGCCGGGTTTCTCCCGTTCCGGGGCGACCATTTCA
GGTGGGATGCTGATGGGGGTGAGCCGTTACGCTGCTTCCGAGTTTTCGTTCCTGCTGGCGGTGCCGATGATGATGGGCGCAACGGCGCTC
GATCTCTACAAAAGCTGGGGCTTCCTGACAAGCGGCGATATCCCGATGTTTGCCGTTGGGTTTATCACCGCTTTTGTGGTGGCGCTGATA
GCGATTAAAACCTTCCTGCAATTGATTAAGCGCATTTCGTTTATCCCGTTCGCCATTTATCGCTTTATTGTGGCGGCTGCGGTGTATGTC
GTGTTCTTTTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

bacA

Prevalence: protein homolog model (view sequences)

Graph