Enterococcus faecium liaS mutant conferring daptomycin resistance

Accession ARO:3003079
Synonym(s)yvqC
CARD Short NameEfac_liaS_DAP
DefinitionliaS is a histidine kinase found in the liaFSR signal transduction pathway. Mutations confer daptomycin resistance.
AMR Gene Familydaptomycin resistant liaS
Drug Classpeptide antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Classification12 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic daptomycin [Antibiotic]
+ antibiotic resistant liaFSR system
+ daptomycin resistant liaS [AMR Gene Family]
Publications

Arias CA, et al. 2011. N Engl J Med 365(10): 892-900. Genetic basis for in vivo daptomycin resistance in enterococci. (PMID 21899450)

Munita JM, et al. 2012. Antimicrob Agents Chemother 56(8): 4354-4359. Correlation between mutations in liaFSR of Enterococcus faecium and MIC of daptomycin: revisiting daptomycin breakpoints. (PMID 22664970)

Resistomes

Prevalence of Enterococcus faecium liaS mutant conferring daptomycin resistance among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 650

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
T120Asingle resistance variantPMID:22664970
A180Tsingle resistance variantPMID:21899450
E192Gsingle resistance variantPMID:22664970
H264Qsingle resistance variantPMID:22664970

>gb|AFK58561.1|+|Enterococcus faecium liaS mutant conferring daptomycin resistance [Enterococcus faecium DO]
MMGKISRAMLAVYSGIAAFLIILFSLFTYFYASNQSHWWGELLRARLLYVPLIFHLLAIS
LGVGLIVFLLLSLIQKTKYGKIEEKLRALSSGNYESKLLLLPIPSASDDLYIKDIDKEIT
KIKEKMIEVSSELQIVTSRPQYVDGQTKEEILELERHRLARELHDSVSQQLFAAMMMMSA
LTEQAEKSETPEMFRKQLKMVAEIINASQSEMRALLLHLRPVNLEEKSLKQGIEQLLKEL
QNKIQISLKWDVEDVKLSSSIEDHLFRIVQELLSNTLRHAKANELEVYLHKIDNNLLLRI
IDDGTGFNMNETKTGSYGLNNIKERVAGIGGTVKIISFKGQGTSVEIKVPLMKEA



>gb|CP003583.1|+|913746-914813|Enterococcus faecium liaS mutant conferring daptomycin resistance [Enterococcus faecium DO]
ATGATGGGAAAAATATCCAGAGCGATGCTAGCTGTTTATTCGGGGATTGCGGCTTTCCTTATTATTCTATTTTCACTTTTCACTTATTTT
TATGCCAGCAATCAAAGTCATTGGTGGGGAGAATTACTGCGTGCACGTTTATTATATGTTCCGCTTATCTTCCATTTGTTAGCCATTTCC
TTAGGTGTAGGATTAATTGTCTTTCTATTATTATCACTTATTCAAAAGACAAAATACGGGAAAATCGAAGAAAAGCTGCGTGCACTTTCT
TCTGGCAATTATGAATCCAAATTGTTGCTTCTTCCGATCCCAAGTGCATCGGACGATTTATACATCAAAGATATTGATAAGGAAATCACT
AAGATAAAAGAAAAAATGATTGAAGTATCTAGTGAATTACAAATTGTAACGAGCCGTCCCCAATATGTAGATGGACAAACCAAAGAAGAA
ATTTTAGAATTAGAAAGACATCGATTAGCCCGTGAGCTGCATGATTCAGTTTCGCAACAATTGTTTGCAGCAATGATGATGATGTCGGCA
TTGACGGAGCAAGCAGAAAAAAGCGAGACACCAGAAATGTTTCGCAAGCAGTTGAAAATGGTAGCAGAGATCATCAACGCTTCCCAGTCT
GAGATGCGTGCGCTGCTTCTTCATCTACGTCCAGTCAATTTAGAAGAGAAAAGTTTAAAGCAAGGTATCGAGCAGTTATTGAAGGAATTG
CAAAATAAAATCCAGATTTCGCTGAAATGGGATGTAGAAGATGTAAAACTATCTAGTTCCATTGAGGATCACTTGTTCCGAATCGTTCAA
GAATTGTTATCAAATACATTAAGACATGCTAAAGCCAATGAATTAGAGGTATATTTGCACAAAATAGACAATAATCTTTTGTTACGTATT
ATTGACGACGGAACAGGGTTTAATATGAATGAAACGAAAACGGGAAGTTATGGATTGAACAATATCAAAGAACGAGTAGCTGGTATTGGT
GGAACAGTAAAAATCATTAGTTTTAAAGGTCAAGGTACAAGTGTAGAAATCAAGGTCCCTTTGATGAAGGAGGCATAG

Curator Acknowledgements
Curator Description Most Recent Edit