fosA5

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003209
CARD Short NamefosA5
DefinitionfosA5 is a fosfomycin resistance gene isolated from clinical strain of Escherichia coli E265. It is susceptible to amikacin, tetracycline and imipenem, and resistant to sulphonamide, cephalosporins, gentamicin, ciprofloxacin, chloramphenicol and streptomycin.
AMR Gene Familyfosfomycin thiol transferase
Drug Classphosphonic acid antibiotic, aminoglycoside antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEnterobacter cloacae (2), Klebsiella pneumoniae (2)
GAZ
FOODON
ENVO
UBERON
Classification13 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ fosfomycin thiol transferase [AMR Gene Family]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
Resistomes with Perfect MatchesCitrobacter freundiiwgs, Enterobacter hormaecheip+wgs, Escherichia colig+wgs, Klebsiella pneumoniaeg+wgs, Serratia marcescensp
Resistomes with Sequence VariantsCitrobacter freundiiwgs, Cronobacter malonaticuswgs, Enterobacter hormaecheip+wgs, Escherichia colig+wgs, Klebsiella aerogenesg+wgs, Klebsiella huaxiensisg+wgs, Klebsiella michiganensisg+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+wgs+gi, Klebsiella quasipneumoniaeg+wgs, Raoultella planticolag+wgs, Serratia marcescensp, Shigella flexneriwgs
Publications

Ma Y, et al. 2015. Lett Appl Microbiol 60(3): 259-264. Characterization of fosA5, a new plasmid-mediated fosfomycin resistance gene in Escherichia coli. (PMID 25441705)

Resistomes

Prevalence of fosA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter freundii0%0%0.19%0%0%
Cronobacter malonaticus0%0%5.45%0%0%
Enterobacter hormaechei0%0.06%0.26%0%0%
Escherichia coli0.02%0%0.05%0%0%
Klebsiella aerogenes92%0%94.35%0%0%
Klebsiella huaxiensis100%0%100%0%0%
Klebsiella michiganensis96.77%0%97.34%0%0%
Klebsiella oxytoca97.44%0.68%99.16%0%0%
Klebsiella pneumoniae14.56%0%13.87%1.9%0%
Klebsiella quasipneumoniae5.88%0%6.71%0%0%
Raoultella planticola100%0%100%0%0%
Serratia marcescens0%0.65%0%0%0%
Shigella flexneri0%0%0.16%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|AJE60855.1|-|fosA5 [Escherichia coli]
MLSGLNHLTLAVSQLAPSVAFYQQLLGMMLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVA
VWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFAE


>gb|KP143090.1|-|1200-1619|fosA5 [Escherichia coli]
ATGCTGAGTGGACTGAATCACCTGACCCTGGCAGTCAGCCAGCTGGCGCCGAGCGTGGCGTTTTATCAGCAGCTGCTGGGCATGATGCTG
CATGCCCGCTGGGACAGCGGGGCTTATCTCTCCTGCGGCGATCTGTGGCTGTGCCTGTCGCTGGATCCGCAGCGGCGCGTTACTCCGCCG
GAAGAGAGCGACTACACCCATTATGCGTTTAGTATTAGCGAAGCCGATTTTGCTAGCTTCGCCGCCCGCCTTGAGGCTGCCGGCGTAGCG
GTCTGGAAGCTGAACCGTAGCGAAGGCGCTTCGCACTATTTCCTCGATCCCGATGGCCATAAGCTGGAGCTGCACGTCGGCAGTCTCGCC
CAGCGTCTGGCCGCCTGCCGCGAGCAGCCGTATAAGGGGATGGTGTTTTTTGCTGAGTGA

Curator Acknowledgements
Curator Description Most Recent Edit