mdtN

Download Sequences

Accession	ARO:3003548
Synonym(s)	sdsR yjcR
CARD Short Name	mdtN
Definition	Multidrug resistance efflux pump. Could be involved in resistance to puromycin, acriflavine and tetraphenylarsonium chloride.
AMR Gene Family	major facilitator superfamily (MFS) antibiotic efflux pump
Drug Class	nucleoside antibiotic, disinfecting agents and antiseptics
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Escherichia coli^g+p+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^wgs, Shigella flexneri^g+wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Escherichia albertii^g+wgs, Escherichia coli^g+p+wgs, Escherichia marmotae^g+wgs, Klebsiella oxytoca^p, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + nucleoside antibiotic [Drug Class] + determinant of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + disinfecting agents and antiseptics [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + aminonucleoside antibiotic + major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family] + puromycin [Antibiotic] + acriflavine [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + subunit of efflux pump conferring antibiotic resistance + part_of MdtNOP
Publications	Sulavik MC, et al. 2001. Antimicrob Agents Chemother 45(4): 1126-1136. Antibiotic susceptibility profiles of Escherichia coli strains lacking multidrug efflux pump genes. (PMID 11257026) Dinh T, et al. 1994. J. Bacteriol. 176(13):3825-31 A family of extracytoplasmic proteins that allow transport of large molecules across the outer membranes of gram-negative bacteria. (PMID 8021163) Shimada T, et al. 2009. J. Bacteriol. 191(14):4562-71 Involvement of the leucine response transcription factor LeuO in regulation of the genes for sulfa drug efflux. (PMID 19429622)

Resistomes

Prevalence of mdtN among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia albertii	98.57%	0%	96.13%	0%	0%
Escherichia coli	66.87%	0.02%	98.04%	0%	99.6%
Escherichia coli	21.75%	0.01%	29.02%	0%	33.64%
Escherichia marmotae	100%	0%	95.83%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Klebsiella oxytoca	0%	0.68%	0%	0%	0%
Klebsiella oxytoca	0%	0%	0%	0%	0%
Shigella boydii	13.33%	0%	8.89%	0%	0%
Shigella boydii	60%	0%	61.11%	0%	0%
Shigella dysenteriae	0%	0%	3.33%	0%	0%
Shigella dysenteriae	21.43%	0%	33.33%	0%	0%
Shigella flexneri	18%	0%	0.47%	0%	0%
Shigella flexneri	99%	0%	97.52%	0%	0%
Shigella sonnei	100%	0%	95.69%	0%	0%
Shigella sonnei	0%	0%	1.39%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 600

Protein
DNA

>gb|BAE78084.1|-|mdtN [Escherichia coli str. K-12 substr. W3110]
MESTPKKAPRSKFPALLVVALALVALVFVIWRVDSAPSTNDAYASADTIDVVPEVSGRIVELAVTDNQAVKQGDLLFRIDPRPYEANLAK
AEASLAALDKQIMLTQRSVDAQQFGADSVNATVEKARAAAKQATDTLRRTEPLLKEGFVSAEDVDRARTAQRAAEADLNAVLLQAQSAAS
AVSGVDALVAQRAAVEADIALTKLHLEMATVRAPFDGRVISLKTSVGQFASAMRPIFTLIDTRHWYVIANFRETDLKNIRSGTPATIRLM
SDSGKTFEGKVDSIGYGVLPDDGGLVLGGLPKVSRSINWVRVAQRFPVKIMVDKPDPEMFRIGASAVANLEPQ

>gb|AP009048.1|-|4306557-4307588|mdtN [Escherichia coli str. K-12 substr. W3110]
ATGGAAAGTACGCCGAAAAAAGCTCCTCGCAGTAAATTCCCTGCTCTGTTAGTGGTTGCGTTGGCGCTGGTTGCCCTTGTTTTCGTTATC
TGGCGCGTAGACAGTGCGCCATCAACTAATGACGCTTACGCGTCAGCAGATACCATTGATGTGGTACCGGAAGTCAGCGGCCGCATTGTA
GAACTGGCGGTCACCGACAACCAGGCAGTCAAACAGGGCGATTTGCTGTTCCGCATCGACCCGCGCCCGTACGAAGCCAATCTGGCGAAA
GCTGAAGCCTCCCTCGCGGCGCTGGATAAGCAAATTATGCTCACCCAGCGTAGCGTTGACGCGCAACAGTTTGGTGCCGACTCGGTTAAT
GCCACGGTAGAAAAAGCCCGTGCCGCCGCGAAACAGGCCACAGATACATTACGCCGCACCGAGCCATTACTGAAAGAAGGTTTTGTCTCA
GCGGAAGATGTTGACCGTGCAAGAACGGCGCAGCGCGCCGCAGAAGCGGATCTTAATGCCGTATTGTTACAGGCGCAGTCAGCCGCCAGC
GCCGTCAGCGGCGTGGATGCATTAGTTGCCCAGCGTGCGGCGGTCGAAGCGGATATTGCCCTGACCAAACTGCATCTGGAAATGGCGACC
GTTCGCGCGCCGTTTGATGGCCGGGTCATTTCCCTCAAAACCTCCGTCGGGCAATTTGCTTCTGCCATGCGCCCTATTTTTACCCTAATC
GACACTCGTCACTGGTATGTGATCGCCAACTTCCGCGAAACCGATCTGAAAAATATTCGCTCAGGTACACCCGCAACGATTCGCCTGATG
AGTGACAGCGGCAAAACCTTCGAGGGTAAAGTGGATTCGATTGGCTACGGCGTGCTACCGGATGACGGCGGCCTGGTGCTGGGCGGCCTG
CCGAAAGTGTCTCGTTCTATTAACTGGGTCCGCGTTGCCCAGCGTTTTCCGGTCAAAATCATGGTCGATAAACCTGACCCGGAAATGTTC
CGCATCGGCGCTTCGGCAGTCGCTAATCTTGAGCCGCAATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

mdtN

Prevalence: protein homolog model (view sequences)

Graph