OpmH

Accession ARO:3003682
DefinitionOpmH is an outer membrane efflux protein required for triclosan-specific efflux pump function.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, phenicol antibiotic, acridine dye, aminoglycoside antibiotic, monobactam, macrolide antibiotic, fluoroquinolone antibiotic, glycylcycline, triclosan, aminocoumarin antibiotic, penam, carbapenem, antibacterial free fatty acids, diaminopyrimidine antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesPseudomonas fluorescensg
Classification23 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Mima T, et al. 2007. J Bacteriol 189(21): 7600-7609. Identification and characterization of TriABC-OpmH, a triclosan efflux pump of Pseudomonas aeruginosa requiring two membrane fusion proteins. (PMID 17720796)

Chuanchuen R, et al. 2005. Antimicrob. Agents Chemother. 49(5):2133-6 Substrate-dependent utilization of OprM or OpmH by the Pseudomonas aeruginosa MexJK efflux pump. (PMID 15855547)

Resistomes

Prevalence of OpmH among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecium0%0%0%
Escherichia coli0%0%0%
Klebsiella oxytoca0%0%0%
Klebsiella pneumoniae0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Stenotrophomonas maltophilia0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 850


>gb|AAG08359.1|+|OpmH [Pseudomonas aeruginosa PAO1]
MLRRLSLAAAVAAATGVAWAAQPTPLPTKTDLISVYKEAVDNNADLAAAQADYLARKEVVPQARAGLLPQLGAGARVGDTRIAFDERPAT
VKRNSQVVQATLSQPLFRADRWFQWQAAKETSDQARLEFSATQQDLILRSAETYFTVLRAQDNLATSKAEEAAFKRQLDQANERFDVGLS
DKTDVLEAQASYDTARANRLIAEQRVDDAFQALVTLTNRDYSAIEGMRHTLPVVPPAPNDAKAWVDTAVQQNLRLLASNYAVNAAEETLR
QRKAGHLPTLDAVAQYQKGDNDALGFANSAANPLVHYGKYVDERSIGLELNIPIYSGGLTSSQVRESYQRLNQSEQSREGQRRQVVQDTR
NLHRAVNTDVEQVQARRQAIISNQSSLEATEIGYQVGTRNIVDVLNAQRQLYAAVRDYNNSRYDYILDTLRLKQAAGTLSPADLEALSAY
LKQDYDPDKDFLPPDLAKAAAEQLQSKPRQQY


>gb|AE004091.2|+|5584101-5585549|OpmH [Pseudomonas aeruginosa PAO1]
ATGCTGCGCAGACTCTCCCTGGCGGCCGCCGTGGCCGCTGCTACCGGTGTCGCCTGGGCCGCCCAGCCGACCCCGCTGCCGACCAAGACC
GACCTGATCAGCGTCTACAAGGAAGCCGTCGACAACAACGCCGACCTCGCCGCCGCCCAGGCCGACTACCTGGCGCGCAAGGAAGTGGTG
CCCCAGGCCCGCGCCGGCCTGCTGCCGCAACTCGGCGCCGGCGCCCGCGTCGGAGACACCCGGATCGCATTCGACGAGCGTCCGGCGACC
GTCAAGCGCAACAGCCAGGTCGTCCAGGCCACCCTCAGCCAGCCGTTGTTCCGCGCCGACCGCTGGTTCCAGTGGCAGGCCGCCAAGGAA
ACCAGCGACCAGGCCCGGCTGGAATTCTCCGCGACCCAGCAGGACCTGATCCTGCGCAGCGCCGAGACCTACTTCACGGTGCTCCGCGCC
CAGGACAACCTGGCCACCAGCAAGGCCGAGGAAGCCGCCTTCAAGCGCCAGCTGGACCAGGCCAACGAGCGCTTCGACGTGGGCCTTTCC
GACAAGACCGACGTGCTCGAGGCCCAGGCCAGCTACGACACCGCCCGCGCCAACCGGTTGATCGCCGAACAGCGCGTGGACGATGCCTTC
CAGGCCCTGGTGACCCTGACCAACCGCGACTACAGCGCCATCGAGGGCATGCGCCACACCCTGCCGGTGGTGCCGCCGGCGCCGAACGAC
GCCAAGGCCTGGGTCGACACCGCGGTGCAGCAGAACCTGCGCCTGCTGGCCAGCAACTACGCGGTCAACGCCGCCGAGGAAACCCTCCGC
CAGCGCAAGGCCGGGCACCTGCCGACCCTCGATGCCGTGGCCCAGTACCAGAAGGGCGACAACGACGCCCTCGGCTTCGCCAACAGCGCC
GCCAATCCGCTGGTGCACTATGGCAAGTATGTCGACGAGCGCAGCATTGGCCTGGAACTGAACATCCCGATCTACAGCGGCGGCCTGACC
TCCTCCCAGGTCCGCGAGTCCTACCAGCGCCTCAACCAGAGCGAGCAATCCCGCGAAGGCCAGCGCCGCCAGGTGGTGCAGGATACCCGC
AACCTGCACCGCGCGGTGAATACCGACGTCGAGCAGGTCCAGGCGCGGCGCCAGGCGATCATCTCCAACCAGAGTTCGCTGGAAGCCACC
GAGATCGGCTACCAGGTCGGCACCCGCAACATCGTCGACGTGCTCAACGCCCAGCGCCAGCTGTACGCCGCCGTGCGCGACTACAACAAC
AGCCGCTACGACTACATCCTCGATACCCTGCGCCTGAAGCAGGCGGCCGGCACCCTCAGCCCGGCCGACCTGGAGGCGCTCAGCGCCTAC
CTGAAGCAGGACTACGATCCGGACAAGGACTTCCTCCCGCCGGACCTGGCCAAGGCCGCCGCCGAGCAGTTACAGAGCAAGCCGCGCCAG
CAGTACTAG