vanW gene in vanI cluster

Download Sequences
Accession ARO:3003724
Synonym(s)vanW-I vanWI
CARD Short NamevanW_in_vanI_cl
DefinitionAlso known as vanWI, is a vanW variant found in the vanI gene cluster.
AMR Gene Familyglycopeptide resistance gene cluster, vanW
Drug Classglycopeptide antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Sequence VariantsActinomyces viscosusg+wgs, Anaerostipes hadrusg+wgs, Bacillus anthracisg+wgs, Bacillus cereusg+p+wgs, Bacillus halotoleransg+wgs, Bacillus pumiluswgs, Bacillus subtilisg+wgs, Bacillus tequilensisg+wgs, Bacillus thuringiensisg+p+wgs, Brevibacillus brevisg+wgs, Brevibacillus laterosporusg+wgs, Christensenella minutag+wgs, Clostridium botulinumg+wgs, Clostridium butyricumg+wgs, Clostridium perfringensg+wgs, Clostridium septicumg+wgs, Clostridium sporogenesg+wgs, Clostridium tetanig+wgs, Comamonas testosteroniwgs, Corynebacterium amycolatumg+wgs, Corynebacterium diphtheriaeg+wgs, Corynebacterium imitansg+wgs, Corynebacterium jeikeiumg+wgs, Corynebacterium matruchotiig+wgs, Corynebacterium pseudotuberculosisg+wgs, Corynebacterium ulceransg+wgs, Corynebacterium urealyticumg+wgs, Corynebacterium ureicelerivoransg+wgs, Deinococcus radioduransg+wgs, Dysosmobacter welbionisg+wgs, Eggerthella lentag+wgs, Enterobacter roggenkampiiwgs, Enterocloster clostridioformisg+wgs, Erysipelatoclostridium ramosumg+wgs, Glutamicibacter creatinolyticusg, Gordonibacter urolithinfaciensg+wgs, Herbinix luporumg+wgs, Inquilinus limosuswgs, Klebsiella pneumoniaewgs, Lachnoclostridium phocaeenseg, Massilistercora timonensisg, Megasphaera stantoniig+wgs, Mobiluncus mulieriswgs, Nocardia asiaticawgs, Nocardia exalbidawgs, Nocardia farcinicag+p+wgs, Paenibacillus mucilaginosusg+wgs, Paeniclostridium sordelliig+wgs, Parvimonas micrag+wgs, Peptacetobacter hiranonisg+wgs, Peptoniphilus hareig+wgs, Phoenicibacter congonensisg, Rhodococcus pyridinivoransg+wgs, Rhodococcus rhodochrousg+wgs, Roseburia hominisg+wgs, Vibrio vulnificuswgs
Classification13 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ vanW [AMR Gene Family]
+ part_of glycopeptide resistance gene cluster VanI
Publications

Kalan L, et al. 2009. Antimicrob. Agents Chemother. 53(7):2841-5 Noncanonical vancomycin resistance cluster from Desulfitobacterium hafniense Y51. (PMID 19414574)

Nonaka H, et al. 2006. J. Bacteriol. 188(6):2262-74 Complete genome sequence of the dehalorespiring bacterium Desulfitobacterium hafniense Y51 and comparison with Dehalococcoides ethenogenes 195. (PMID 16513756)
Resistomes

Prevalence of vanW gene in vanI cluster among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Actinomyces viscosus100%0%100%0%0%
Anaerostipes hadrus100%0%100%0%0%
Bacillus anthracis100%0%100.44%0%0%
Bacillus cereus100%0.3%103.99%0%0%
Bacillus halotolerans100%0%97.3%0%0%
Bacillus pumilus0%0%0.56%0%0%
Bacillus subtilis87.1%0%96.24%0%0%
Bacillus tequilensis100%0%100%0%0%
Bacillus thuringiensis100%0.13%100.35%0%0%
Brevibacillus brevis100%0%100%0%0%
Brevibacillus laterosporus100%0%100%0%0%
Christensenella minuta100%0%120%0%0%
Clostridium botulinum97.01%0%100%0%0%
Clostridium butyricum66.67%0%98.04%0%0%
Clostridium perfringens100%0%99.76%0%0%
Clostridium septicum100%0%100%0%0%
Clostridium sporogenes100%0%100.85%0%0%
Clostridium tetani100%0%100%0%0%
Comamonas testosteroni0%0%7.14%0%0%
Corynebacterium amycolatum100%0%100%0%0%
Corynebacterium diphtheriae100%0%100%0%0%
Corynebacterium imitans100%0%100%0%0%
Corynebacterium jeikeium100%0%100%0%0%
Corynebacterium matruchotii100%0%100%0%0%
Corynebacterium pseudotuberculosis100%0%100%0%0%
Corynebacterium ulcerans100%0%100%0%0%
Corynebacterium urealyticum100%0%100%0%0%
Corynebacterium ureicelerivorans100%0%100%0%0%
Deinococcus radiodurans52%0%100%0%0%
Dysosmobacter welbionis100%0%100%0%0%
Eggerthella lenta100%0%98.96%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Enterocloster clostridioformis100%0%118.6%0%0%
Erysipelatoclostridium ramosum100%0%100%0%0%
Glutamicibacter creatinolyticus100%0%0%0%0%
Gordonibacter urolithinfaciens100%0%100%0%0%
Herbinix luporum100%0%100%0%0%
Inquilinus limosus0%0%50%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Lachnoclostridium phocaeense100%0%0%0%0%
Massilistercora timonensis100%0%0%0%0%
Megasphaera stantonii100%0%100%0%0%
Mobiluncus mulieris0%0%97.06%0%0%
Nocardia asiatica0%0%100%0%0%
Nocardia exalbida0%0%100%0%0%
Nocardia farcinica75%8.33%100%0%0%
Paenibacillus mucilaginosus100%0%100%0%0%
Paeniclostridium sordellii100%0%100%0%0%
Parvimonas micra100%0%100%0%0%
Peptacetobacter hiranonis100%0%150%0%0%
Peptoniphilus harei100%0%100%0%0%
Phoenicibacter congonensis100%0%0%0%0%
Rhodococcus pyridinivorans100%0%100%0%0%
Rhodococcus rhodochrous100%0%100%0%0%
Roseburia hominis100%0%100%0%0%
Vibrio vulnificus0%0%0.41%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 50


>gb|BAE83690.1|-|vanW gene in vanI cluster [Desulfitobacterium hafniense Y51]
MLRRKPWVFLLVILFSQLSLSILLGATVTYGAGYAKAPEGLTVWEKDLGGMTKDEAYAVLAEVIPKAVVYDRTVYFLELNQTDQDLKDYL
ASQYIISTGNVITDAFEYLHRMSRTIPSPELLNQEEVLAQLRKFALDIDQPGKAAEAYYENGEIVIEEGSLGVRLDVDKSWEQLQQSIGM
ETVPLVTEVIVVHPTTAELEKVKDPLGDYTTYFNPSFHERVTNVRLAAEAINGLILPPGGEFSFNDTVGKREPERGYLPALMYMGNRVVT
DDGGGICQDSTTLYQATKQARLEVLERYSHSLPVSYVPLGQDATVAYGALDFRFRNTTQGYLLLNAATGGNWIRVRIFGVADSEHPALDE
PDGYPVKPREWSK


>gb|AP008230.1|-|2195401-2196522|vanW gene in vanI cluster [Desulfitobacterium hafniense Y51]
ATGTTAAGAAGGAAACCATGGGTCTTTCTTTTGGTAATTTTATTTAGTCAGCTTAGCTTATCTATACTTTTGGGGGCTACGGTAACCTAC
GGTGCGGGTTATGCGAAGGCACCCGAGGGGTTGACGGTTTGGGAAAAAGATCTGGGTGGGATGACCAAGGATGAGGCCTATGCAGTCCTT
GCCGAAGTAATCCCCAAGGCAGTCGTCTATGACCGGACGGTTTATTTCTTGGAGCTAAACCAAACCGATCAAGATCTAAAGGACTATCTG
GCAAGTCAATACATCATTTCCACCGGAAATGTTATTACGGATGCCTTTGAGTACCTGCACAGAATGTCAAGGACTATCCCGTCTCCTGAG
TTACTCAATCAGGAGGAAGTTCTTGCTCAGCTCCGCAAGTTCGCCCTGGATATCGATCAGCCGGGTAAGGCGGCTGAAGCCTATTATGAG
AATGGCGAGATCGTCATCGAAGAGGGCAGTTTGGGAGTCAGACTTGATGTGGACAAATCATGGGAACAACTGCAGCAAAGCATAGGCATG
GAGACGGTGCCGCTTGTTACGGAGGTCATAGTGGTTCACCCTACTACGGCCGAATTAGAGAAGGTCAAAGATCCCTTGGGGGATTACACC
ACCTATTTTAACCCTTCCTTTCATGAACGGGTTACCAATGTACGGCTTGCGGCTGAAGCGATCAATGGACTTATTCTTCCGCCGGGTGGT
GAATTCTCCTTTAATGATACGGTGGGAAAACGTGAGCCTGAAAGAGGGTATTTGCCGGCTTTAATGTATATGGGCAATAGAGTTGTCACA
GATGATGGCGGAGGGATTTGCCAGGATTCGACCACTCTTTATCAAGCGACCAAACAGGCCAGGCTGGAAGTGCTGGAAAGATACAGCCAT
TCTCTGCCGGTTTCCTATGTTCCGTTGGGGCAGGATGCTACGGTTGCTTATGGAGCGCTGGATTTCCGCTTTCGGAACACGACTCAGGGT
TATTTGCTGCTTAATGCAGCTACAGGCGGCAATTGGATTCGGGTAAGAATTTTCGGTGTGGCCGATTCTGAACACCCTGCCCTTGACGAA
CCGGACGGTTATCCTGTAAAACCCAGAGAATGGTCAAAGTAA

Curator Acknowledgements
Curator Description Most Recent Edit