kdpE

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003841
CARD Short NamekdpE
DefinitionkdpE is a transcriptional activator that is part of the two-component system KdpD/KdpE that is studied for its regulatory role in potassium transport and has been identified as an adaptive regulator involved in the virulence and intracellular survival of pathogenic bacteria. kdpE regulates a range of virulence loci through direct promoter binding.
AMR Gene Familyantibiotic efflux regulatory protein, kdpDE
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic efflux
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Resistomes with Perfect MatchesEscherichia colig+p+wgs, Shigella boydiig+wgs, Shigella flexnerig+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsCitrobacter amalonaticusg+wgs, Citrobacter freundiig+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Escherichia marmotaeg+wgs, Klebsiella pneumoniaewgs, Salmonella bongorig+wgs, Salmonella entericag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Publications

Hirakawa H, et al. 2003. J Bacteriol 185(6): 1851-1856. Comprehensive studies of drug resistance mediated by overexpression of response regulators of two-component signal transduction systems in Escherichia coli. (PMID 12618449)

Freeman ZN, et al. 2013. PLoS Pathog. 9(3):e1003201 The KdpD/KdpE two-component system: integrating K⁺ homeostasis and virulence. (PMID 23555240)

Resistomes

Prevalence of kdpE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter amalonaticus100%0%100%0%0%
Citrobacter freundii100%0%99.03%0%0%
Citrobacter koseri93.75%0%99.1%0%0%
Citrobacter portucalensis96.3%0%99.1%0%0%
Citrobacter werkmanii100%0%100%0%0%
Citrobacter youngae100%0%100%0%0%
Escherichia albertii100%0%99.35%0%0%
Escherichia coli67.34%0.01%98.23%0%99.65%
Escherichia fergusonii98.36%0.36%97.83%0%0%
Escherichia marmotae100%0%97.92%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Salmonella bongori100%0%94.74%0%0%
Salmonella enterica95.52%0%98.83%0%0%
Shigella boydii100%0%95.56%0%0%
Shigella dysenteriae100%0%100%0%0%
Shigella flexneri65%0%20.19%0%0%
Shigella sonnei100%0%98.76%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAC73788.1|-|kdpE [Escherichia coli str. K-12 substr. MG1655]
MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAA
LDAGADDYLSKPFGIGELQARLRVALRRHSATTAPDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQV
WGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML


>gb|U00096.3|-|721056-721733|kdpE [Escherichia coli str. K-12 substr. MG1655]
GTGACAAACGTTCTGATTGTTGAAGATGAACAGGCTATTCGTCGCTTTCTGCGCACGGCGCTGGAGGGCGACGGGATGCGCGTCTTTGAG
GCCGAAACGCTGCAACGCGGCTTGCTGGAAGCGGCAACCCGTAAGCCAGATTTGATTATTCTCGATCTCGGCCTGCCCGATGGTGATGGG
ATTGAGTTTATCCGCGACCTGCGCCAGTGGAGCGCGGTGCCGGTGATTGTGCTTTCCGCACGCAGCGAAGAGAGCGACAAAATCGCCGCG
CTGGATGCCGGAGCGGATGATTATCTGAGTAAGCCGTTTGGCATTGGCGAATTGCAGGCCCGTCTGCGCGTCGCATTACGCCGCCACTCT
GCCACCACCGCGCCCGATCCGCTGGTAAAATTTTCCGATGTTACCGTCGATTTAGCCGCCCGCGTGATTCACCGGGGTGAGGAAGAGGTG
CATCTCACACCAATTGAGTTCCGCCTGCTGGCGGTGCTGCTCAACAATGCCGGAAAAGTACTCACCCAGCGCCAGCTCCTTAACCAGGTG
TGGGGGCCAAACGCGGTCGAACACAGTCACTATTTGCGTATTTATATGGGACATCTGCGACAAAAACTGGAACAGGATCCCGCCCGCCCA
CGCCATTTCATTACTGAAACCGGTATTGGCTATCGGTTTATGCTTTGA

Curator Acknowledgements
Curator Description Most Recent Edit