leuO

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003843
CARD Short NameleuO
DefinitionleuO, a LysR family transcription factor, exists in a wide variety of bacteria of the family Enterobacteriaceae and is involved in the regulation of as yet unidentified genes affecting the stress response and pathogenesis expression. LeuO is also an activator of the MdtNOP efflux pump.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classnucleoside antibiotic, disinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification13 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ regulates MdtNOP
+ antibiotic efflux regulatory protein [AMR Gene Family]
Resistomes with Perfect MatchesEscherichia colig+wgs, Shigella flexnerig, Shigella sonneiwgs
Resistomes with Sequence VariantsCitrobacter amalonaticusg+wgs, Citrobacter freundiig+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Enterobacter asburiaeg+wgs, Enterobacter cancerogenusg+wgs, Enterobacter chengduensisg+wgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiig+wgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella aerogenesg+wgs, Klebsiella huaxiensisg+wgs, Klebsiella michiganensisg+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+wgs, Klebsiella quasipneumoniaeg+wgs, Leclercia adecarboxylatag+wgs, Salmonella bongorig+wgs, Salmonella entericag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Publications

Shimada T, et al. 2009. J. Bacteriol. 191(14):4562-71 Involvement of the leucine response transcription factor LeuO in regulation of the genes for sulfa drug efflux. (PMID 19429622)

Shimada T, et al. 2011. Mol. Microbiol. 82(2):378-97 Novel roles of LeuO in transcription regulation of E. coli genome: antagonistic interplay with the universal silencer H-NS. (PMID 21883529)

Resistomes

Prevalence of leuO among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter amalonaticus100%0%100%0%0%
Citrobacter freundii99.18%0%97.1%0%0%
Citrobacter koseri100%0%100%0%0%
Citrobacter portucalensis100%0%99.1%0%0%
Citrobacter werkmanii100%0%100%0%0%
Citrobacter youngae100%0%100%0%0%
Enterobacter asburiae93.55%0%97.23%0%0%
Enterobacter cancerogenus100%0%100%0%0%
Enterobacter chengduensis100%0%100%0%0%
Enterobacter cloacae96.43%0%97.76%0%0%
Enterobacter hormaechei98.56%0%97.76%0%0%
Enterobacter kobei90.91%0%93.01%0%0%
Enterobacter roggenkampii86.05%0%96.04%0%0%
Escherichia albertii100%0%100%0%0%
Escherichia coli66.63%0.01%98.13%0%98.98%
Escherichia fergusonii100%0%96.74%0%0%
Escherichia marmotae100%0%87.5%0%0%
Klebsiella aerogenes98%0%99.44%0%0%
Klebsiella huaxiensis100%0%66.67%0%0%
Klebsiella michiganensis96.77%0%99.2%0%0%
Klebsiella oxytoca100%0%97.06%0%0%
Klebsiella pneumoniae99.59%0%99%0%0%
Klebsiella quasipneumoniae100%0%99.08%0%0%
Leclercia adecarboxylata100%0%100%0%0%
Salmonella bongori100%0%100%0%0%
Salmonella enterica95.08%0%99.02%0%0%
Shigella boydii86.67%0%94.44%0%0%
Shigella dysenteriae21.43%0%30%0%0%
Shigella flexneri98%0%99.38%0%0%
Shigella sonnei100%0%96.86%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|VWQ00850.1|+|leuO [Escherichia coli]
MPEVQTDHPETAELSKPQLRMVDLNLLTVFDAVMQEQNITRAAHALGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVR
QALQLVQNELPGSGFEPASSERVFHLCVCSPLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQLRYQETEFVISYEDFHRPEFTSVP
LFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASFSQTWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAES
LELQVLPLPLKQNSRTCYLSWHEAAGRDKGHQWMEEQLVSICKR


>gb|LR730402.1|+|740043-740987|leuO [Escherichia coli]
ATGCCAGAGGTACAAACAGATCATCCAGAGACGGCGGAGTTAAGCAAGCCACAGCTACGCATGGTCGATCTCAACTTATTAACCGTTTTC
GATGCCGTGATGCAGGAGCAAAACATCACCCGTGCCGCTCATGCTCTGGGAATGTCGCAACCTGCGGTCAGTAACGCTGTTGCACGCCTG
AAGGTGATGTTTAATGACGAGCTTTTTGTTCGTTATGGCCGTGGTATTCAACCGACTGCTCGCGCATTTCAACTTTTTGGCTCAGTTCGT
CAGGCATTGCAACTAGTACAAAATGAATTGCCTGGTTCAGGTTTTGAACCCGCGAGCAGTGAACGTGTATTTCATCTTTGTGTTTGCAGC
CCGTTAGACAGCATTCTGACCTCGCAGATTTATAATCACATTGAGCAGATTGCGCCAAATATACATGTTATGTTCAAGTCTTCATTAAAT
CAGAACACTGAACATCAGCTGCGTTATCAGGAAACGGAGTTTGTGATTAGTTATGAAGACTTCCATCGCCCTGAATTTACCAGTGTGCCA
TTATTTAAAGATGAAATGGTGTTGGTAGCCAGCAAAAATCATCCAACAATTAAAGGCCCGTTACTGAAGCATGATGTTTATAACGAACAA
CACGCTGCGGTTTCGCTCGATCGTTTCGCATCATTTAGTCAAACCTGGTATGACACGGTAGATAAGCAAGCCAGTATCGCGTATCAGGGC
ATGGCAATGATGAGCGTACTTAGCGTGGTGTCGCAAACGCATCTGGTCGCTATTGCGCCGCGTTGGTTGGCTGAAGAGTTCGCTGAATCC
TTAGAGTTACAGGTATTACCGCTGCCGTTAAAACAAAACAGCAGAACCTGTTATCTCTCCTGGCATGAAGCTGCCGGGCGCGATAAAGGC
CATCAGTGGATGGAAGAGCAATTAGTCTCAATTTGCAAACGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit