leuO

Download Sequences

Accession	ARO:3003843
CARD Short Name	leuO
Definition	leuO, a LysR family transcription factor, exists in a wide variety of bacteria of the family Enterobacteriaceae and is involved in the regulation of as yet unidentified genes affecting the stress response and pathogenesis expression. LeuO is also an activator of the MdtNOP efflux pump.
AMR Gene Family	major facilitator superfamily (MFS) antibiotic efflux pump
Drug Class	nucleoside antibiotic, disinfecting agents and antiseptics
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Efflux Regulator	protein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Perfect Matches	Escherichia coli^g+wgs, Shigella flexneri^g, Shigella sonnei^wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^g+wgs, Citrobacter freundii^g+wgs, Citrobacter koseri^g+wgs, Citrobacter portucalensis^g+wgs, Citrobacter werkmanii^g+wgs, Citrobacter youngae^g+wgs, Enterobacter asburiae^g+wgs, Enterobacter cancerogenus^g+wgs, Enterobacter chengduensis^g+wgs, Enterobacter cloacae^g+wgs, Enterobacter hormaechei^g+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^g+wgs, Escherichia albertii^g+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^g+wgs, Escherichia marmotae^g+wgs, Klebsiella aerogenes^g+wgs, Klebsiella huaxiensis^g+wgs, Klebsiella michiganensis^g+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+wgs, Klebsiella quasipneumoniae^g+wgs, Leclercia adecarboxylata^g+wgs, Salmonella bongori^g+wgs, Salmonella enterica^g+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + nucleoside antibiotic [Drug Class] + determinant of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + disinfecting agents and antiseptics [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + aminonucleoside antibiotic + major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family] + puromycin [Antibiotic] + acriflavine [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + protein(s) and two-component regulatory system modulating antibiotic efflux [Efflux Regulator] + regulates MdtNOP
Publications	Shimada T, et al. 2009. J. Bacteriol. 191(14):4562-71 Involvement of the leucine response transcription factor LeuO in regulation of the genes for sulfa drug efflux. (PMID 19429622) Shimada T, et al. 2011. Mol. Microbiol. 82(2):378-97 Novel roles of LeuO in transcription regulation of E. coli genome: antagonistic interplay with the universal silencer H-NS. (PMID 21883529)

Resistomes

Prevalence of leuO among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	100%	0%	100%	0%	0%
Citrobacter amalonaticus	0%	0%	0%	0%	0%
Citrobacter freundii	99.18%	0%	97.1%	0%	0%
Citrobacter freundii	0%	0%	0%	0%	0%
Citrobacter koseri	100%	0%	100%	0%	0%
Citrobacter koseri	0%	0%	0%	0%	0%
Citrobacter portucalensis	100%	0%	99.1%	0%	0%
Citrobacter portucalensis	0%	0%	0%	0%	0%
Citrobacter werkmanii	100%	0%	100%	0%	0%
Citrobacter werkmanii	0%	0%	0%	0%	0%
Citrobacter youngae	0%	0%	0%	0%	0%
Citrobacter youngae	100%	0%	100%	0%	0%
Enterobacter asburiae	93.55%	0%	97.23%	0%	0%
Enterobacter asburiae	0%	0%	0%	0%	0%
Enterobacter cancerogenus	0%	0%	0%	0%	0%
Enterobacter cancerogenus	100%	0%	100%	0%	0%
Enterobacter chengduensis	0%	0%	0%	0%	0%
Enterobacter chengduensis	100%	0%	100%	0%	0%
Enterobacter cloacae	96.43%	0%	97.76%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0%	0%	0%
Enterobacter hormaechei	98.56%	0%	97.76%	0%	0%
Enterobacter kobei	90.91%	0%	93.01%	0%	0%
Enterobacter kobei	0%	0%	0%	0%	0%
Enterobacter roggenkampii	86.05%	0%	96.04%	0%	0%
Enterobacter roggenkampii	0%	0%	0%	0%	0%
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia albertii	100%	0%	100%	0%	0%
Escherichia coli	10.1%	0%	17.79%	0%	2.48%
Escherichia coli	66.63%	0.01%	98.13%	0%	98.98%
Escherichia fergusonii	100%	0%	96.74%	0%	0%
Escherichia fergusonii	0%	0%	0%	0%	0%
Escherichia marmotae	100%	0%	87.5%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Klebsiella aerogenes	0%	0%	0%	0%	0%
Klebsiella aerogenes	98%	0%	99.44%	0%	0%
Klebsiella huaxiensis	100%	0%	66.67%	0%	0%
Klebsiella huaxiensis	0%	0%	0%	0%	0%
Klebsiella michiganensis	0%	0%	0%	0%	0%
Klebsiella michiganensis	96.77%	0%	99.2%	0%	0%
Klebsiella oxytoca	0%	0%	0%	0%	0%
Klebsiella oxytoca	100%	0%	97.06%	0%	0%
Klebsiella pneumoniae	0%	0%	0%	0%	0%
Klebsiella pneumoniae	99.59%	0%	99%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0%	0%	0%
Klebsiella quasipneumoniae	100%	0%	99.08%	0%	0%
Leclercia adecarboxylata	0%	0%	0%	0%	0%
Leclercia adecarboxylata	100%	0%	100%	0%	0%
Salmonella bongori	0%	0%	0%	0%	0%
Salmonella bongori	100%	0%	100%	0%	0%
Salmonella enterica	95.08%	0%	99.02%	0%	0%
Salmonella enterica	0%	0%	0%	0%	0%
Shigella boydii	0%	0%	0%	0%	0%
Shigella boydii	86.67%	0%	94.44%	0%	0%
Shigella dysenteriae	0%	0%	0%	0%	0%
Shigella dysenteriae	21.43%	0%	30%	0%	0%
Shigella flexneri	98%	0%	99.38%	0%	0%
Shigella flexneri	1%	0%	0%	0%	0%
Shigella sonnei	100%	0%	96.86%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|VWQ00850.1|+|leuO [Escherichia coli]
MPEVQTDHPETAELSKPQLRMVDLNLLTVFDAVMQEQNITRAAHALGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVR
QALQLVQNELPGSGFEPASSERVFHLCVCSPLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQLRYQETEFVISYEDFHRPEFTSVP
LFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASFSQTWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAES
LELQVLPLPLKQNSRTCYLSWHEAAGRDKGHQWMEEQLVSICKR

>gb|LR730402.1|+|740043-740987|leuO [Escherichia coli]
ATGCCAGAGGTACAAACAGATCATCCAGAGACGGCGGAGTTAAGCAAGCCACAGCTACGCATGGTCGATCTCAACTTATTAACCGTTTTC
GATGCCGTGATGCAGGAGCAAAACATCACCCGTGCCGCTCATGCTCTGGGAATGTCGCAACCTGCGGTCAGTAACGCTGTTGCACGCCTG
AAGGTGATGTTTAATGACGAGCTTTTTGTTCGTTATGGCCGTGGTATTCAACCGACTGCTCGCGCATTTCAACTTTTTGGCTCAGTTCGT
CAGGCATTGCAACTAGTACAAAATGAATTGCCTGGTTCAGGTTTTGAACCCGCGAGCAGTGAACGTGTATTTCATCTTTGTGTTTGCAGC
CCGTTAGACAGCATTCTGACCTCGCAGATTTATAATCACATTGAGCAGATTGCGCCAAATATACATGTTATGTTCAAGTCTTCATTAAAT
CAGAACACTGAACATCAGCTGCGTTATCAGGAAACGGAGTTTGTGATTAGTTATGAAGACTTCCATCGCCCTGAATTTACCAGTGTGCCA
TTATTTAAAGATGAAATGGTGTTGGTAGCCAGCAAAAATCATCCAACAATTAAAGGCCCGTTACTGAAGCATGATGTTTATAACGAACAA
CACGCTGCGGTTTCGCTCGATCGTTTCGCATCATTTAGTCAAACCTGGTATGACACGGTAGATAAGCAAGCCAGTATCGCGTATCAGGGC
ATGGCAATGATGAGCGTACTTAGCGTGGTGTCGCAAACGCATCTGGTCGCTATTGCGCCGCGTTGGTTGGCTGAAGAGTTCGCTGAATCC
TTAGAGTTACAGGTATTACCGCTGCCGTTAAAACAAAACAGCAGAACCTGTTATCTCTCCTGGCATGAAGCTGCCGGGCGCGATAAAGGC
CATCAGTGGATGGAAGAGCAATTAGTCTCAATTTGCAAACGCTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

leuO

Prevalence: protein homolog model (view sequences)

Graph