rpsJ

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003930
Synonym(s)nusE
CARD Short NamerpsJ
DefinitionrpsJ is a tetracycline resistance protein identified in Neisseria gonorrhoeae. Tetracycline resistance is conferred by binding to the ribosome as a 30S ribosomal protection protein.
AMR Gene Familytetracycline-resistant ribosomal protection protein
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic target protection
Classification7 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ tetracycline-resistant ribosomal protection protein [AMR Gene Family]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
Resistomes with Sequence VariantsNeisseria brasiliensiswgs, Neisseria gonorrhoeaeg+p+wgs, Neisseria meningitidisg+wgs
Publications

Kubanov A, et al. 2016. BMC Infect. Dis. 16:389 Molecular epidemiology of drug-resistant Neisseria gonorrhoeae in Russia (Current Status, 2015). (PMID 27506605)

Resistomes

Prevalence of rpsJ among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Neisseria brasiliensis0%0%100%0%0%
Neisseria gonorrhoeae60%1.02%83%0%0%
Neisseria meningitidis6.11%0%6.9%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 200

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
V57Lsingle resistance variantPMID:27506605
V57Msingle resistance variantPMID:27506605

>gb|AAW90462.1|-|rpsJ [Neisseria gonorrhoeae FA 1090]
MANQKIRIRLKAYDYALIDRSAQEIVETAKRTGAVVKGPIPLPTKIERFNILRSPHVNKT
SREQLEIRTHLRLMDIVDWTDKTTDALMKLDLPAGVDVEIKVQ



>gb|AE004969.1|-|1807359-1807670|rpsJ [Neisseria gonorrhoeae FA 1090]
ATGGCAAACCAAAAAATCCGTATCCGCCTGAAAGCTTATGATTACGCCCTGATTGACCGTTCTGCACAAGAAATCGTTGAAACTGCAAAA
CGTACCGGTGCTGTTGTAAAAGGCCCGATTCCTTTGCCGACCAAAATCGAGCGTTTCAACATTTTGCGTTCTCCGCACGTGAACAAAACT
TCCCGTGAACAATTGGAAATCCGCACCCATTTGCGCCTGATGGACATCGTGGATTGGACCGATAAAACTACCGATGCGCTGATGAAGCTG
GATTTGCCGGCCGGTGTTGATGTAGAAATTAAAGTCCAATAA

Curator Acknowledgements
Curator Description Most Recent Edit